Homo sapiens coagulation factor II (thrombin) receptor (F2R), mRNA.
| RefSeq Version | NM_001992.3, 166362739 |
| Length | 3847 bp |
| Structure | linear |
| Update Date | 17-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens coagulation factor II (thrombin) receptor (F2R), mRNA. |
| Product | proteinase-activated receptor 1 precursor |
| Comment | Summary: Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. [provided by RefSeq]. |
| RefSeq | NP_001983.2 |
| CDS | 266..1543 | Exon (1) | 1..353 | Exon (2) | 1..353 | Exon (3) | 354..3810 |
| Translation | MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 80 | + | a, c | dbSNP:112752462 |
| 112 | + | a, g | dbSNP:113795600 |
| 121 | + | a, g | dbSNP:115576918 |
| 132 | + | c, t | dbSNP:73127597 |
| 197 | + | a, g | dbSNP:2227745 |
| 228 | + | a, g | dbSNP:1800819 |
| 307 | + | g, t | dbSNP:6896558 |
| 341 | + | g, t | dbSNP:112841414 |
| 460 | + | g, t | dbSNP:116853936 |
| 650 | + | c, t | dbSNP:5895 |
| 761 | + | a, g | dbSNP:5893 |
| 781 | + | g, t | dbSNP:5894 |
| 824 | + | a, t | dbSNP:2230849 |
| 1034 | + | g, t | dbSNP:2227832 |
| 1067 | + | c, g | dbSNP:1055103 |
| 1269 | + | c, t | dbSNP:17849599 |
| 1311 | + | c, t | dbSNP:111993668 |
| 1500 | + | a, c | dbSNP:2227799 |
| 1587 | + | c, t | dbSNP:2227800 |
| 2213 | + | a, g | dbSNP:111660890 |
| 2271 | + | a, c | dbSNP:113734071 |
| 2357..2358 | + | , c | dbSNP:34314266 |
| 2465 | + | g, t | dbSNP:78844532 |
| 2467 | + | a, g | dbSNP:77720360 |
| 2482 | + | c, t | dbSNP:41272244 |
| 2909 | + | a, c | dbSNP:2227801 |
| 2939 | + | c, t | dbSNP:2227802 |
| 3010 | + | a, t | dbSNP:17568523 |
| 3011 | + | c, t | dbSNP:1801719 |
| 3069 | + | a, g | dbSNP:2227803 |
| 3250 | + | a, c | dbSNP:1801718 |
| 3383 | + | a, g | dbSNP:2227805 |
| 3450 | + | c, t | dbSNP:2227806 |
| 3624 | + | a, c | dbSNP:1055222 |
| 3747 | + | a, c | dbSNP:1055227 |
| Gene Symbol | F2R |
| Gene Synonym | CF2R; HTR; PAR-1; PAR1; TR |
| Chromosome | 5 |
| Locus Map | 5q13 |
| All Transcripts | NM_001992 |
| Title | Vasodilator-stimulated phosphoprotein deficiency potentiates PAR-1-induced increase in endothelial permeability in mouse lungs . |
| Author | Profirovic,J., Han,J., Andreeva,A.V., Neamu,R.F., Pavlovic,S., Vogel,S.M., Walter,U. and Voyno-Yasenetskaya,T.A. |
| Journal | J. Cell. Physiol. 226 (5), 1255-1264 (2011) |
| Title | The endothelial protein C receptor supports tissue factor ternary coagulation initiation complex signaling through protease-activated receptors . |
| Author | Disse,J., Petersen,H.H., Larsen,K.S., Persson,E., Esmon,N., Esmon,C.T., Teyton,L., Petersen,L.C. and Ruf,W. |
| Journal | J. Biol. Chem. 286 (7), 5756-5767 (2011) |
| Title | Protease-activated receptor signaling in platelets activates cytosolic phospholipase A2alpha differently for cyclooxygenase-1 and 12-lipoxygenase catalysis . |
| Author | Holinstat,M., Boutaud,O., Apopa,P.L., Vesci,J., Bala,M., Oates,J.A. and Hamm,H.E. |
| Journal | Arterioscler. Thromb. Vasc. Biol. 31 (2), 435-442 (2011) |
| Title | Protease activated receptor-1 inhibits the Maspin tumor-suppressor gene to determine the melanoma metastatic phenotype . |
| Author | Villares,G.J., Zigler,M., Dobroff,A.S., Wang,H., Song,R., Melnikova,V.O., Huang,L., Braeuer,R.R. and Bar-Eli,M. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 108 (2), 626-631 (2011) |
| Title | The coagulation system contributes to alphaVbeta6 integrin expression and liver fibrosis induced by cholestasis . |
| Author | Sullivan,B.P., Weinreb,P.H., Violette,S.M. and Luyendyk,J.P. |
| Journal | Am. J. Pathol. 177 (6), 2837-2849 (2010) |
| Title | Solid tumor cells express functional 'tethered ligand' thrombin receptor . |
| Author | Wojtukiewicz,M.Z., Tang,D.G., Ben-Josef,E., Renaud,C., Walz,D.A. and Honn,K.V. |
| Journal | Cancer Res. 55 (3), 698-704 (1995) |
| Title | Intracellular targeting and trafficking of thrombin receptors. A novel mechanism for resensitization of a G protein-coupled receptor . |
| Author | Hein,L., Ishii,K., Coughlin,S.R. and Kobilka,B.K. |
| Journal | J. Biol. Chem. 269 (44), 27719-27726 (1994) |
| Title | Characterization of a functional thrombin receptor. Issues and opportunities . |
| Author | Coughlin,S.R., Vu,T.K., Hung,D.T. and Wheaton,V.I. |
| Journal | J. Clin. Invest. 89 (2), 351-355 (1992) |
| Title | The G protein coupled to the thromboxane A2 receptor in human platelets is a member of the novel Gq family . |
| Author | Shenker,A., Goldsmith,P., Unson,C.G. and Spiegel,A.M. |
| Journal | J. Biol. Chem. 266 (14), 9309-9313 (1991) |
| Title | Molecular cloning of a functional thrombin receptor reveals a novel proteolytic mechanism of receptor activation . |
| Author | Vu,T.K., Hung,D.T., Wheaton,V.I. and Coughlin,S.R. |
| Journal | Cell 64 (6), 1057-1068 (1991) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |