• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibroblast growth factor receptor 4 (FGFR4), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27932 Homo sapiens fibroblast growth factor receptor 4 (FGFR4), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu27932C Homo sapiens fibroblast growth factor receptor 4 (FGFR4), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002011.4, 634743315
Length 2409 bp
Structure linear
Update Date 11-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens fibroblast growth factor receptor 4 (FGFR4), transcript variant 1, mRNA.
Product fibroblast growth factor receptor 4 isoform 1 precursor
Comment

Summary: The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. The genomic organization of this gene, compared to members 1-3, encompasses 18 exons rather than 19 or 20. Although alternative splicing has been observed, there is no evidence that the C-terminal half of the IgIII domain of this protein varies between three alternate forms, as indicated for members 1-3. This particular family member preferentially binds acidic fibroblast growth factor and, although its specific function is unknown, it is overexpressed in gynecological tumor samples, suggesting a role in breast and ovarian tumorigenesis. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longest isoform (1), which contains a transmembrane domain, suggesting a membrane bound receptor. Variants 1 and 3 encode the same isoform 1.

RefSeq NP_002002.3
CDS 216..2624
Misc Feature(1)363..536
Misc Feature(2)684..938
Misc Feature(3)708..908
Misc Feature(4)981..1265
Misc Feature(5)1005..1268
Misc Feature(6)order(1032..1034,1047..1055,1140..1145,1161..1163,
Misc Feature(7)1323..1385
Misc Feature(8)1575..2516
Misc Feature(9)1614..2444
Misc Feature(10)order(1632..1646,1656..1658,1716..1718,1722..1724,
Misc Feature(11)order(1632..1646,1656..1658,1716..1718,1722..1724,
Misc Feature(12)order(1644..1646,1884..1886,1890..1892,2049..2051,
Misc Feature(13)order(2100..2120,2166..2177)
Misc Feature(14)2139..2141
Misc Feature(15)2142..2144
Misc Feature(16)2475..2477
Misc Feature(17)2475..2477
Exon (1)1..162
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (2)163..306
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (3)307..570
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (4)571..651
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (5)652..818
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (6)819..942
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (7)943..1133
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (8)1134..1272
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (9)1273..1466
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (10)1467..1612
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (11)1613..1734
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (12)1735..1845
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (13)1846..2036
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (14)2037..2159
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (15)2160..2230
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (16)2231..2368
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (17)2369..2474
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Exon (18)2475..3090
Gene:FGFR4
Gene Synonym:CD334; JTK2; TKF
Translation MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS VFSHDPLPLGSSSFPFGSGVQT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolFGFR4
Gene SynonymCD334; JTK2; TKF
Chromosome5
Locus Map5q35.2
Title Irritable bowel syndrome-diarrhea: characterization of genotype by exome sequencing, and phenotypes of bile acid synthesis and colonic transit .
Author Camilleri M, Klee EW, Shin A, Carlson P, Li Y, Grover M and Zinsmeister AR.
Journal Am. J. Physiol. Gastrointest. Liver Physiol. 306 (1), G13-G26 (2014)
Title Combination of the FGFR4 inhibitor PD173074 and 5-fluorouracil reduces proliferation and promotes apoptosis in gastric cancer .
Author Ye YW, Hu S, Shi YQ, Zhang XF, Zhou Y, Zhao CL, Wang GJ, Wen JG and Zong H.
Journal Oncol. Rep. 30 (6), 2777-2784 (2013)
Title FGFR4 promotes stroma-induced epithelial-to-mesenchymal transition in colorectal cancer .
Author Liu R, Li J, Xie K, Zhang T, Lei Y, Chen Y, Zhang L, Huang K, Wang K, Wu H, Wu M, Nice EC, Huang C and Wei Y.
Journal Cancer Res. 73 (19), 5926-5935 (2013)
Title Fibroblast growth factor receptor 4 Gly388Arg polymorphism in Chinese gastric cancer patients .
Author Shen YY, Lu YC, Shen DP, Liu YJ, Su XY, Zhu GS, Yin XL and Ni XZ.
Journal World J. Gastroenterol. 19 (28), 4568-4575 (2013)
Title Targeted genetic dependency screen facilitates identification of actionable mutations in FGFR4, MAP3K9, and PAK5 in lung cancer .
Author Fawdar S, Trotter EW, Li Y, Stephenson NL, Hanke F, Marusiak AA, Edwards ZC, Ientile S, Waszkowycz B, Miller CJ and Brognard J.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (30), 12426-12431 (2013)
Title Fibroblast growth factor receptor-4 shows novel features in genomic structure, ligand binding and signal transduction .
Author Vainikka S, Partanen J, Bellosta P, Coulier F, Birnbaum D, Basilico C, Jaye M and Alitalo K.
Journal EMBO J. 11 (12), 4273-4280 (1992)
Title A radiation hybrid map of 18 growth factor, growth factor receptor, hormone receptor, or neurotransmitter receptor genes on the distal region of the long arm of chromosome 5 .
Author Warrington JA, Bailey SK, Armstrong E, Aprelikova O, Alitalo K, Dolganov GM, Wilcox AS, Sikela JM, Wolfe SF and Lovett M.
Journal Genomics 13 (3), 803-808 (1992)
Title Localization of the fibroblast growth factor receptor-4 gene to chromosome region 5q33-qter .
Author Armstrong E, Partanen J, Cannizzaro L, Huebner K and Alitalo K.
Journal Genes Chromosomes Cancer 4 (1), 94-98 (1992)
Title Two additional protein-tyrosine kinases expressed in human lung: fourth member of the fibroblast growth factor receptor family and an intracellular protein-tyrosine kinase .
Author Holtrich U, Brauninger A, Strebhardt K and Rubsamen-Waigmann H.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (23), 10411-10415 (1991)
Title FGFR-4, a novel acidic fibroblast growth factor receptor with a distinct expression pattern .
Author Partanen J, Makela TP, Eerola E, Korhonen J, Hirvonen H, Claesson-Welsh L and Alitalo K.
Journal EMBO J. 10 (6), 1347-1354 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.