• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens Friend leukemia virus integration 1 (FLI1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002017 Homo sapiens Friend leukemia virus integration 1 (FLI1), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_002017.4, 401871074
Length 3995 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens Friend leukemia virus integration 1 (FLI1), transcript variant 1, mRNA.
Product Friend leukemia integration 1 transcription factor isoform 1
Comment

Summary: This gene encodes a transcription factor containing an ETS DNA-binding domain. The gene can undergo a t(11;22)(q24;q12) translocation with the Ewing sarcoma gene on chromosome 22, which results in a fusion gene that is present in the majority of Ewing sarcoma cases. An acute lymphoblastic leukemia-associated t(4;11)(q21;q23) translocation involving this gene has also been identified. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012].


Transcript Variant: This variant (1) encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002008.2
CDS 344..1702
Misc Feature(1)263..265
Misc Feature(2)683..955
Misc Feature(3)683..955
Misc Feature(4)1181..1432
Exon (1)1..361
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (2)362..573
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (3)574..728
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (4)729..932
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (5)933..998
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (6)999..1064
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (7)1065..1124
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (8)1125..1172
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (9)1173..3981
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Translation MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQ PVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTN ERRVIVPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATT LYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNK SPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF DFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
27..52+dbSNP:
27..52+, gagagagagagagagagagagagagadbSNP:57930585
27..28+, gadbSNP:68049599
258+a, cdbSNP:145654087
316+c, tdbSNP:112860445
391+dbSNP:
391+a, gdbSNP:1053256
417+c, tdbSNP:200865469
454+a, gdbSNP:201047249
467+a, tdbSNP:148200397
538+c, tdbSNP:186120614
546+g, tdbSNP:201118331
549+a, tdbSNP:1132722
595+dbSNP:
595+a, cdbSNP:146694829
622+c, tdbSNP:185251679
731+dbSNP:
731+c, gdbSNP:1132723
810+c, tdbSNP:180719406
820+c, gdbSNP:201473472
894+c, tdbSNP:199855586
895+a, gdbSNP:201742274
957+dbSNP:
957+c, tdbSNP:200254689
973+a, gdbSNP:35195224
1030+dbSNP:
1030+a, tdbSNP:7113191
1076+dbSNP:
1076+a, gdbSNP:201425969
1090+c, gdbSNP:200640652
1113+a, gdbSNP:199555637
1285+dbSNP:
1285+c, gdbSNP:61733405
1309+c, tdbSNP:200962985
1473+a, cdbSNP:201671275
1514+c, tdbSNP:1053261
1520+a, gdbSNP:139830377
1534+a, gdbSNP:201109280
1598+g, tdbSNP:186156572
1710+c, tdbSNP:149837029
2023+c, tdbSNP:74630747
2042+a, cdbSNP:41302401
2052+c, tdbSNP:41302403
2102+g, tdbSNP:41302405
2179+c, tdbSNP:1053264
2288+c, tdbSNP:147953720
2307+a, gdbSNP:141891993
2311+a, gdbSNP:147030479
2330+a, cdbSNP:7130622
2406+, tdbSNP:201085556
2530+c, tdbSNP:190134547
2573+a, gdbSNP:181502037
2666+c, tdbSNP:147660004
2769+a, gdbSNP:186058867
3061+c, tdbSNP:142350198
3081+g, tdbSNP:190817266
3163+c, tdbSNP:143267974
3260+a, cdbSNP:113905165
3273+g, tdbSNP:148337526
3279+g, tdbSNP:682695
3305+g, tdbSNP:111491175
3425+a, cdbSNP:1148066
3508+c, tdbSNP:114437685
3701+a, gdbSNP:184045466
3731+c, tdbSNP:187498128
3865+c, tdbSNP:141254318
Gene SymbolFLI1
Gene SynonymEWSR2; SIC-1
Chromosome11
Locus Map11q24.1-q24.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001167681 Homo sapiens Friend leukemia virus integration 1 (FLI1), transcript variant 2, mRNA. In-stock $509.00 $460.00 12
NM_001271010 Homo sapiens Friend leukemia virus integration 1 (FLI1), transcript variant 3, mRNA. On-demand $549.00 14
NM_001271012 Homo sapiens Friend leukemia virus integration 1 (FLI1), transcript variant 4, mRNA. On-demand $449.00 14
NM_002017 Homo sapiens Friend leukemia virus integration 1 (FLI1), transcript variant 1, mRNA. In-stock $509.00 $460.00 12
Title Transcription factors Fli1 and EKLF in the differentiation of megakaryocytic and erythroid progenitor in 5q- syndrome and in Diamond-Blackfan anemia .
Author Neuwirtova,R., Fuchs,O., Holicka,M., Vostry,M., Kostecka,A., Hajkova,H., Jonasova,A., Cermak,J., Cmejla,R., Pospisilova,D., Belickova,M., Siskova,M., Hochova,I., Vondrakova,J., Sponerova,D., Kadlckova,E., Novakova,L., Brezinova,J. and Michalova,K.
Journal Ann. Hematol. 92 (1), 11-18 (2013)
Title SNP array and phenotype correlation shows that FLI1 deletion per se is not responsible for thrombocytopenia development in Jacobsen syndrome .
Author Trkova,M., Becvarova,V., Hynek,M., Hnykova,L., Hlavova,E., Kreckova,G., Kulovany,E., Cutka,D., Zatloukalova,J., Markova,K., Sukova,M., Horacek,J. and Stejskal,D.
Journal Am. J. Med. Genet. A 158A (10), 2545-2550 (2012)
Title Targeting the EWSR1-FLI1 oncogene-induced protein kinase PKC-beta abolishes ewing sarcoma growth .
Author Surdez,D., Benetkiewicz,M., Perrin,V., Han,Z.Y., Pierron,G., Ballet,S., Lamoureux,F., Redini,F., Decouvelaere,A.V., Daudigeos-Dubus,E., Geoerger,B., de Pinieux,G., Delattre,O. and Tirode,F.
Journal Cancer Res. 72 (17), 4494-4503 (2012)
Title Utility of immunohistochemical staining with FLI1, D2-40, CD31, and CD34 in the diagnosis of acquired immunodeficiency syndrome-related and non-acquired immunodeficiency syndrome-related Kaposi sarcoma .
Author Rosado,F.G., Itani,D.M., Coffin,C.M. and Cates,J.M.
Journal Arch. Pathol. Lab. Med. 136 (3), 301-304 (2012)
Title Molecular analysis of a t(11;22) translocation junction in a case of Ewing's sarcoma .
Author Bhagirath,T., Abe,S., Nojima,T. and Yoshida,M.C.
Journal Genes Chromosomes Cancer 13 (2), 126-132 (1995)
Title Structure and expression of human Fli-1 gene .
Author Prasad,D.D., Rao,V.N. and Reddy,E.S.
Journal Cancer Res. 52 (20), 5833-5837 (1992)
Title The ERGB/Fli-1 gene: isolation and characterization of a new member of the family of human ETS transcription factors .
Author Watson,D.K., Smyth,F.E., Thompson,D.M., Cheng,J.Q., Testa,J.R., Papas,T.S. and Seth,A.
Journal Cell Growth Differ. 3 (10), 705-713 (1992)
Title Gene fusion with an ETS DNA-binding domain caused by chromosome translocation in human tumours .
Author Delattre,O., Zucman,J., Plougastel,B., Desmaze,C., Melot,T., Peter,M., Kovar,H., Joubert,I., de Jong,P., Rouleau,G. et al.
Journal Nature 359 (6391), 162-165 (1992)
Title The human homolog of the mouse common viral integration region, FLI1, maps to 11q23-q24 .
Author Baud,V., Lipinski,M., Rassart,E., Poliquin,L. and Bergeron,D.
Journal Genomics 11 (1), 223-224 (1991)
Title Identification of a common viral integration region in Cas-Br-E murine leukemia virus-induced non-T-, non-B-cell lymphomas .
Author Bergeron,D., Poliquin,L., Kozak,C.A. and Rassart,E.
Journal J. Virol. 65 (1), 7-15 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.