• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens Fli-1 proto-oncogene, ETS transcription factor (FLI1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002017 Homo sapiens Fli-1 proto-oncogene, ETS transcription factor (FLI1), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_002017.4, 401871074
Length 3995 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens Fli-1 proto-oncogene, ETS transcription factor (FLI1), transcript variant 1, mRNA.
Product Friend leukemia integration 1 transcription factor isoform 1
Comment

Summary: This gene encodes a transcription factor containing an ETS DNA-binding domain. The gene can undergo a t(11;22)(q24;q12) translocation with the Ewing sarcoma gene on chromosome 22, which results in a fusion gene that is present in the majority of Ewing sarcoma cases. An acute lymphoblastic leukemia-associated t(4;11)(q21;q23) translocation involving this gene has also been identified. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012].


Transcript Variant: This variant (1) encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002008.2
CDS 344..1702
Misc Feature(1)263..265
Misc Feature(2)683..955
Misc Feature(3)683..955
Misc Feature(4)1181..1432
Exon (1)1..361
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (2)362..573
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (3)574..728
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (4)729..932
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (5)933..998
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (6)999..1064
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (7)1065..1124
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (8)1125..1172
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Exon (9)1173..3981
Gene:FLI1
Gene Synonym:EWSR2; SIC-1
Translation MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQ PVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTN ERRVIVPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATT LYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNK SPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF DFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
27..30+dbSNP:
27..30+, gagadbSNP:376755059
53..78+, gagagagagagagagagagagagagadbSNP:57930585
77..78+, gadbSNP:68049599
258+a, cdbSNP:145654087
294+a, gdbSNP:372817629
315+c, tdbSNP:376557878
316+c, tdbSNP:112860445
385+dbSNP:
385+c, tdbSNP:370876689
391+a, gdbSNP:1053256
413+a, gdbSNP:373912179
417+c, tdbSNP:200865469
447+a, cdbSNP:370622805
454+a, gdbSNP:201047249
467+a, tdbSNP:148200397
485+a, tdbSNP:368549466
491+c, gdbSNP:371445653
538+c, tdbSNP:186120614
546+g, tdbSNP:201118331
549+a, tdbSNP:1132722
583+dbSNP:
583+a, gdbSNP:368251838
595+a, cdbSNP:146694829
596+a, gdbSNP:377050968
622+c, tdbSNP:185251679
633+c, gdbSNP:368969366
681+c, tdbSNP:373376557
683+c, tdbSNP:375828068
691+c, tdbSNP:376782867
703+c, tdbSNP:370809611
719+a, gdbSNP:374178191
724+c, tdbSNP:376181944
731+dbSNP:
731+c, gdbSNP:1132723
810+c, tdbSNP:180719406
820+c, gdbSNP:201473472
826+c, tdbSNP:375288472
873+a, gdbSNP:370316451
874+c, tdbSNP:367910414
875+a, gdbSNP:372454174
894+c, tdbSNP:199855586
895+a, gdbSNP:201742274
957+dbSNP:
957+c, tdbSNP:200254689
973+a, gdbSNP:35195224
981+a, gdbSNP:369164251
997+a, gdbSNP:374117160
1030+dbSNP:
1030+a, tdbSNP:7113191
1076+dbSNP:
1076+a, gdbSNP:201425969
1082+a, gdbSNP:370779379
1089+c, tdbSNP:375560426
1090+c, gdbSNP:200640652
1094+a, gdbSNP:370479993
1111+a, gdbSNP:374722269
1113+a, gdbSNP:199555637
1139+dbSNP:
1139+c, tdbSNP:375259681
1148..1149+, gdbSNP:373481448
1168+c, tdbSNP:368505169
1177+dbSNP:
1177+c, tdbSNP:375151134
1210+a, gdbSNP:369900426
1219+c, tdbSNP:369798344
1231+c, tdbSNP:373070689
1285+c, gdbSNP:61733405
1309+c, tdbSNP:200962985
1399+c, tdbSNP:371530389
1411+c, tdbSNP:374459474
1465+c, tdbSNP:377471737
1473+a, cdbSNP:201671275
1501+c, tdbSNP:370266659
1514+c, tdbSNP:1053261
1520+a, gdbSNP:139830377
1534+a, gdbSNP:201109280
1579+c, tdbSNP:367970398
1597+c, tdbSNP:371247490
1598+g, tdbSNP:186156572
1624+a, gdbSNP:374370811
1639+c, tdbSNP:368298758
1648+c, tdbSNP:372364609
1656+a, gdbSNP:375383556
1672+a, cdbSNP:373018480
1673+a, gdbSNP:371183121
1710+c, tdbSNP:149837029
1726+c, tdbSNP:376209645
1738+a, tdbSNP:369195794
2023+c, tdbSNP:74630747
2042+a, cdbSNP:41302401
2052+c, tdbSNP:41302403
2102+g, tdbSNP:41302405
2179+c, tdbSNP:1053264
2266+c, tdbSNP:375154406
complement(2288)-t, cdbSNP:147953720
2307+a, gdbSNP:141891993
2311+a, gdbSNP:147030479
2330+a, cdbSNP:7130622
2406+, tdbSNP:201085556
2530+c, tdbSNP:190134547
2573+a, gdbSNP:181502037
2666+c, tdbSNP:147660004
2769+a, gdbSNP:186058867
2787+c, gdbSNP:369649681
3061+c, tdbSNP:142350198
3081+g, tdbSNP:190817266
complement(3163)-t, cdbSNP:143267974
3260+a, cdbSNP:113905165
3273+g, tdbSNP:148337526
complement(3279)-t, gdbSNP:682695
3305+g, tdbSNP:111491175
complement(3425)-c, adbSNP:1148066
3508+c, tdbSNP:114437685
3536+c, gdbSNP:374231560
3701+a, gdbSNP:184045466
3731+c, tdbSNP:187498128
3865+c, tdbSNP:141254318
Gene SymbolFLI1
Gene SynonymEWSR2; SIC-1
Chromosome11
Locus Map11q24.1-q24.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002017 Homo sapiens Fli-1 proto-oncogene, ETS transcription factor (FLI1), transcript variant 1, mRNA. In-stock $509.00 $460.00 12
NM_001271010 Homo sapiens Fli-1 proto-oncogene, ETS transcription factor (FLI1), transcript variant 3, mRNA. On-demand $549.00 14
NM_001167681 Homo sapiens Fli-1 proto-oncogene, ETS transcription factor (FLI1), transcript variant 2, mRNA. In-stock $509.00 $460.00 12
NM_001271012 Homo sapiens Fli-1 proto-oncogene, ETS transcription factor (FLI1), transcript variant 4, mRNA. On-demand $449.00 14
Title Flightless I over-expression impairs skin barrier development, function and recovery following skin blistering .
Author Kopecki Z, Yang GN, Arkell RM, Jackson JE, Melville E, Iwata H, Ludwig RJ, Zillikens D, Murrell DF and Cowin AJ.
Journal J. Pathol. 232 (5), 541-552 (2014)
Title Enrichment of FLI1 and RUNX1 mutations in families with excessive bleeding and platelet dense granule secretion defects .
Author Stockley J, Morgan NV, Bem D, Lowe GC, Lordkipanidze M, Dawood B, Simpson MA, Macfarlane K, Horner K, Leo VC, Talks K, Motwani J, Wilde JT, Collins PW, Makris M, Watson SP and Daly ME.
Journal Blood 122 (25), 4090-4093 (2013)
Title Deregulation of ETS1 and FLI1 contributes to the pathogenesis of diffuse large B-cell lymphoma .
Author Bonetti P, Testoni M, Scandurra M, Ponzoni M, Piva R, Mensah AA, Rinaldi A, Kwee I, Tibiletti MG, Iqbal J, Greiner TC, Chan WC, Gaidano G, Piris MA, Cavalli F, Zucca E, Inghirami G and Bertoni F.
Journal Blood 122 (13), 2233-2241 (2013)
Title 14-3-3 proteins modulate the ETS transcription factor ETV1 in prostate cancer .
Author Oh S, Shin S, Lightfoot SA and Janknecht R.
Journal Cancer Res. 73 (16), 5110-5119 (2013)
Title Molecular analysis of a t(11;22) translocation junction in a case of Ewing's sarcoma .
Author Bhagirath T, Abe S, Nojima T and Yoshida MC.
Journal Genes Chromosomes Cancer 13 (2), 126-132 (1995)
Title Structure and expression of human Fli-1 gene .
Author Prasad DD, Rao VN and Reddy ES.
Journal Cancer Res. 52 (20), 5833-5837 (1992)
Title The ERGB/Fli-1 gene: isolation and characterization of a new member of the family of human ETS transcription factors .
Author Watson DK, Smyth FE, Thompson DM, Cheng JQ, Testa JR, Papas TS and Seth A.
Journal Cell Growth Differ. 3 (10), 705-713 (1992)
Title Gene fusion with an ETS DNA-binding domain caused by chromosome translocation in human tumours .
Author Delattre O, Zucman J, Plougastel B, Desmaze C, Melot T, Peter M, Kovar H, Joubert I, de Jong P and Rouleau G.
Journal Nature 359 (6391), 162-165 (1992)
Title The human homolog of the mouse common viral integration region, FLI1, maps to 11q23-q24 .
Author Baud V, Lipinski M, Rassart E, Poliquin L and Bergeron D.
Journal Genomics 11 (1), 223-224 (1991)
Title Identification of a common viral integration region in Cas-Br-E murine leukemia virus-induced non-T-, non-B-cell lymphomas .
Author Bergeron D, Poliquin L, Kozak CA and Rassart E.
Journal J. Virol. 65 (1), 7-15 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.