• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fms-related tyrosine kinase 1 (FLT1), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_002019 Homo sapiens fms-related tyrosine kinase 1 (FLT1), transcript variant 1, mRNA. ORF Sequence $1405.95
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002019.4, 229892268
Length 7123 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens fms-related tyrosine kinase 1 (FLT1), transcript variant 1, mRNA.
Product vascular endothelial growth factor receptor 1 isoform 1 precursor
Comment

Summary: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.[provided by RefSeq, May 2009].


Transcript Variant: This variant (1) the longest isoform (1). Isoform 1 is a transmembrane protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002010.2
CDS 286..4302
Misc Feature(1)712..942
Misc Feature(2)1018..1266
Misc Feature(3)1342..1557
Misc Feature(4)2002..2223
Misc Feature(5)2266..2529
Misc Feature(6)2320..2520
Misc Feature(7)2560..2625
Misc Feature(8)2584..2589
Misc Feature(9)2740..3768
Misc Feature(10)order(2782..2796,2806..2808,2860..2868,2917..2919,
Misc Feature(11)order(2782..2790,2806..2808,2860..2868,2917..2919,
Misc Feature(12)<3256..3747
Misc Feature(13)order(3349..3351,3361..3363,3457..3471,3496..3498,
Misc Feature(14)3400..3477
Misc Feature(15)3790..3792
Misc Feature(16)3922..3924
Misc Feature(17)4009..4011
Misc Feature(18)4210..4212
Misc Feature(19)4264..4266
Misc Feature(20)4282..4284
Exon (1)1..349
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (2)350..446
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (3)447..673
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (4)674..798
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (5)799..961
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (6)962..1098
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (7)1099..1273
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (8)1274..1391
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (9)1392..1561
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (10)1562..1721
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (11)1722..1836
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (12)1837..1945
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (13)1946..2254
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (14)2255..2401
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (15)2402..2533
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (16)2534..2640
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (17)2641..2773
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (18)2774..2878
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (19)2879..2992
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (20)2993..3081
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (21)3082..3238
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (22)3239..3336
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (23)3337..3459
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (24)3460..3571
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (25)3572..3671
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (26)3672..3777
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (27)3778..3920
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (28)3921..4005
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (29)4006..4100
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Exon (30)4101..7123
Gene:FLT1
Gene Synonym:FLT; FLT-1; VEGFR-1; VEGFR1
Translation MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHK WSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC DFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEA PYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISA PKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIAC CSPPPDYNSVVLYSTPPI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(205)-dbSNP:
complement(205)-, tdbSNP:67573651
complement(207)-t, cdbSNP:146432383
complement(219)-g, adbSNP:113555214
complement(227)-g, adbSNP:55927955
complement(234)-c, adbSNP:56051053
complement(297)-g, adbSNP:191811275
complement(301)-t, cdbSNP:200728664
complement(414)-dbSNP:
complement(414)-t, cdbSNP:192104849
complement(447)-dbSNP:
complement(447)-g, cdbSNP:141440705
complement(464)-t, gdbSNP:56409818
complement(512)-g, adbSNP:201080437
complement(513)-t, cdbSNP:116829674
complement(558)-g, adbSNP:151082301
complement(606)-g, adbSNP:142924808
complement(612)-g, adbSNP:148523280
complement(624)-g, adbSNP:145782140
complement(626)-t, gdbSNP:148901240
complement(631..632)-, tdbSNP:67165626
complement(667)-t, gdbSNP:35073261
complement(680)-dbSNP:
complement(680)-t, cdbSNP:140749618
complement(690)-g, adbSNP:2387856
complement(715)-t, cdbSNP:55974987
complement(748)-t, cdbSNP:116196813
complement(765)-g, adbSNP:147249852
complement(768)-t, cdbSNP:116486684
complement(878)-dbSNP:
complement(878)-g, adbSNP:201044311
complement(920)-t, cdbSNP:114217707
complement(961)-, tdbSNP:66898040
complement(994)-dbSNP:
complement(994)-t, gdbSNP:143703839
complement(997)-g, adbSNP:139202898
complement(1065)-g, adbSNP:56405013
complement(1116)-dbSNP:
complement(1116)-g, adbSNP:201258699
complement(1122)-, cdbSNP:68118030
complement(1124)-t, cdbSNP:141286646
complement(1127)-t, cdbSNP:55687105
complement(1140)-g, cdbSNP:201208741
complement(1195)-t, cdbSNP:75077152
complement(1203)-, tdbSNP:67391627
complement(1233)-t, cdbSNP:148219954
complement(1324)-dbSNP:
complement(1324)-t, cdbSNP:143093353
complement(1345)-g, adbSNP:142333326
complement(1376)-g, adbSNP:137862999
complement(1380)-t, cdbSNP:145266667
complement(1389)-t, cdbSNP:201178970
complement(1442)-dbSNP:
complement(1442)-t, cdbSNP:141378173
complement(1452)-t, cdbSNP:145411874
complement(1504)-g, adbSNP:182000386
complement(1535..1536)-, gtdbSNP:147801308
complement(1538)-g, adbSNP:74559282
complement(1546)-t, adbSNP:199658437
complement(1587)-dbSNP:
complement(1587)-t, cdbSNP:61763178
complement(1608)-t, cdbSNP:200957320
complement(1643)-g, adbSNP:140566073
complement(1668)-t, gdbSNP:151270578
complement(1707)-t, adbSNP:200003810
complement(1714)-t, cdbSNP:201407326
complement(1733)-dbSNP:
complement(1733)-t, cdbSNP:144685868
complement(1759)-g, adbSNP:55675306
complement(1787)-t, g, adbSNP:61763181
complement(1831)-t, cdbSNP:112588014
complement(1867)-dbSNP:
complement(1867)-t, cdbSNP:201823282
complement(1906)-c, adbSNP:200819753
complement(1916)-c, adbSNP:141785971
complement(1919)-t, cdbSNP:141906217
complement(1925)-t, cdbSNP:145358113
complement(1929)-t, cdbSNP:148479824
complement(1939)-t, cdbSNP:202210823
complement(1984)-dbSNP:
complement(1984)-g, cdbSNP:144651121
complement(1989)-t, cdbSNP:17537350
complement(2066)-g, adbSNP:139586546
complement(2085)-c, adbSNP:201226835
complement(2151)-g, cdbSNP:146003506
complement(2152)-t, cdbSNP:142425372
complement(2164)-, adbSNP:72182275
complement(2219)-t, gdbSNP:201670907
complement(2274..2275)-dbSNP:
complement(2274..2275)-, gdbSNP:66657484
complement(2293)-g, cdbSNP:115349395
complement(2302)-t, cdbSNP:137937570
complement(2308)-t, cdbSNP:199945165
complement(2319)-g, cdbSNP:146170931
complement(2346)-g, adbSNP:11843776
complement(2349)-g, adbSNP:148165829
complement(2370)-t, adbSNP:76513207
complement(2430)-dbSNP:
complement(2430)-t, cdbSNP:143837790
complement(2453..2454)-, tdbSNP:67488452
complement(2471)-t, adbSNP:149011471
complement(2477)-t, cdbSNP:138877243
complement(2481)-t, cdbSNP:200672737
complement(2540)-dbSNP:
complement(2540)-g, adbSNP:115085855
complement(2580)-t, gdbSNP:55728991
complement(2591)-g, adbSNP:200840674
complement(2592)-t, cdbSNP:142392658
complement(2667)-dbSNP:
complement(2667)-g, adbSNP:147704881
complement(2702)-, adbSNP:67997947
complement(2799)-dbSNP:
complement(2799)-, adbSNP:138124033
complement(2808..2809)-, cdbSNP:66533628
complement(2847)-t, cdbSNP:61731337
complement(2864)-c, adbSNP:79879948
complement(2866)-t, cdbSNP:78147150
complement(2874)-t, cdbSNP:140461631
complement(2933)-dbSNP:
complement(2933)-g, adbSNP:199497877
complement(2960..2961)-, adbSNP:67023465
complement(3097)-dbSNP:
complement(3097)-t, cdbSNP:35549791
complement(3112)-t, cdbSNP:148112461
complement(3121)-t, cdbSNP:41291686
complement(3136)-t, gdbSNP:142199393
complement(3153)-t, cdbSNP:191324219
complement(3156)-t, adbSNP:148695719
complement(3162)-g, adbSNP:145985203
complement(3186)-t, cdbSNP:56314249
complement(3215)-g, adbSNP:139188790
complement(3222)-t, adbSNP:200622656
complement(3224)-g, adbSNP:116741209
complement(3230)-t, gdbSNP:35832528
complement(3248)-dbSNP:
complement(3248)-t, cdbSNP:149241190
complement(3282)-c, adbSNP:138363615
complement(3307)-t, cdbSNP:202214802
complement(3339)-dbSNP:
complement(3339)-g, adbSNP:150515552
complement(3357)-t, cdbSNP:2296191
complement(3369)-g, adbSNP:141551151
complement(3419)-t, cdbSNP:139361304
complement(3438)-g, adbSNP:55931889
complement(3489)-dbSNP:
complement(3489)-g, adbSNP:2296189
complement(3503)-t, cdbSNP:200028208
complement(3516)-t, gdbSNP:200720678
complement(3525)-g, adbSNP:116034414
complement(3529)-t, cdbSNP:142586121
complement(3540)-g, adbSNP:202073140
complement(3552)-c, adbSNP:138375207
complement(3620)-dbSNP:
complement(3620)-t, cdbSNP:143726778
complement(3652)-t, cdbSNP:61731345
complement(3658)-c, adbSNP:200804718
complement(3672)-dbSNP:
complement(3672)-g, adbSNP:201631321
complement(3689)-t, cdbSNP:139434208
complement(3764)-t, gdbSNP:148958662
complement(3771)-t, adbSNP:150821981
complement(3772)-t, gdbSNP:145693340
complement(3783)-dbSNP:
complement(3783)-t, adbSNP:148901042
complement(3816)-t, cdbSNP:199706466
complement(3825)-c, adbSNP:138652408
complement(3837)-g, adbSNP:55673217
complement(3887)-g, adbSNP:140861115
complement(3924)-dbSNP:
complement(3924)-g, adbSNP:7993418
complement(3983)-g, adbSNP:115595062
complement(4030)-dbSNP:
complement(4030)-g, adbSNP:61226903
complement(4044)-g, adbSNP:200421157
complement(4054)-g, adbSNP:199599880
complement(4085)-g, cdbSNP:201402962
complement(4090)-g, adbSNP:139333864
complement(4134)-c, adbSNP:200740227
complement(4139)-g, cdbSNP:185016302
complement(4221)-g, adbSNP:112735765
complement(4241)-g, adbSNP:199779462
complement(4242)-t, cdbSNP:146247905
complement(4254)-t, cdbSNP:142100250
complement(4275)-c, adbSNP:115088573
complement(4299)-g, adbSNP:201326398
complement(4406)-c, adbSNP:142337416
complement(4459)-, adbSNP:58778671
complement(4649)-g, adbSNP:3812867
complement(4656)-, gdbSNP:56340749
complement(4685)-t, gdbSNP:61192689
complement(4816)-g, cdbSNP:181971091
complement(4870)-t, cdbSNP:137937875
complement(4874)-g, adbSNP:191955653
complement(4956)-t, adbSNP:187125803
complement(5067)-t, cdbSNP:61763575
complement(5184)-g, cdbSNP:150482174
complement(5254)-t, adbSNP:181745479
complement(5331..5333)-, ctcdbSNP:76659252
complement(5331)-, ctcdbSNP:80155938
complement(5333)-, ctcdbSNP:56791288
complement(5392)-t, cdbSNP:7326277
complement(5398)-t, cdbSNP:117529522
complement(5446)-g, adbSNP:148341038
complement(5484)-t, gdbSNP:61763577
complement(5570)-c, adbSNP:3829380
complement(5763)-g, cdbSNP:142404928
complement(5817)-c, adbSNP:9554314
complement(6013)-t, gdbSNP:190047650
complement(6032)-g, adbSNP:147698203
complement(6162)-t, gdbSNP:114853715
complement(6172)-g, cdbSNP:55875014
complement(6184..6185)-, gtdbSNP:57278661
complement(6185..6186)-, gtdbSNP:148965329
complement(6186..6187)-, tgdbSNP:147902884
complement(6187..6188)-, tgdbSNP:35779457
complement(6188)-g, adbSNP:201928642
complement(6282..6283)-, adbSNP:199664236
complement(6282..6283)-, a, aadbSNP:57123861
complement(6295..6296)-, adbSNP:146828355
complement(6296..6297)-, adbSNP:34252053
complement(6296)-, adbSNP:201743756
complement(6330)-t, cdbSNP:61477468
complement(6442)-t, adbSNP:185779793
complement(6504)-c, adbSNP:200996517
complement(6524)-g, adbSNP:181210440
complement(6658)-t, gdbSNP:2093822
complement(6706)-t, cdbSNP:147069020
complement(6793)-t, cdbSNP:188403334
complement(6848)-g, adbSNP:183774291
complement(6910..6911)-, tadbSNP:57119805
complement(6911..6912)-, atdbSNP:202040481
complement(6911)-g, adbSNP:3209052
complement(6940..6947)-, cacacacadbSNP:200186804
complement(6940..6941)-, cc, ccacacacacdbSNP:58634271
complement(6940)-c, adbSNP:9554313
complement(6942..6947)-, cacacadbSNP:147176157
complement(6946..6947)-, cadbSNP:57419092
complement(6948)-c, adbSNP:58290712
complement(6953)-t, cdbSNP:201617060
complement(7041)-g, cdbSNP:115210819
Gene SymbolFLT1
Gene SynonymFLT; FLT-1; VEGFR-1; VEGFR1
Chromosome13
Locus Map13q12
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001159920 Homo sapiens fms-related tyrosine kinase 1 (FLT1), transcript variant 2, mRNA. Full Length $2924.55
ORF Sequence $598.56
NM_001160030 Homo sapiens fms-related tyrosine kinase 1 (FLT1), transcript variant 3, mRNA. Full Length $860.72
ORF Sequence $638.58
NM_001160031 Homo sapiens fms-related tyrosine kinase 1 (FLT1), transcript variant 4, mRNA. Full Length $554.19
ORF Sequence $471.54
NM_002019 Homo sapiens fms-related tyrosine kinase 1 (FLT1), transcript variant 1, mRNA. Full Length $3205.35
ORF Sequence $1405.95
Title A higher maternal choline intake among third-trimester pregnant women lowers placental and circulating concentrations of the antiangiogenic factor fms-like tyrosine kinase-1 (sFLT1) .
Author Jiang,X., Bar,H.Y., Yan,J., Jones,S., Brannon,P.M., West,A.A., Perry,C.A., Ganti,A., Pressman,E., Devapatla,S., Vermeylen,F., Wells,M.T. and Caudill,M.A.
Journal FASEB J. 27 (3), 1245-1253 (2013)
Title PlGF and sVEGFR-1 in chronic subdural hematoma: implications for hematoma development .
Author Kalamatianos,T., Stavrinou,L.C., Koutsarnakis,C., Psachoulia,C., Sakas,D.E. and Stranjalis,G.
Journal J. Neurosurg. 118 (2), 353-357 (2013)
Title Expression of vascular endothelial growth factor receptors VEGFR1 in cultured multiple myeloma cells: correlation with immunophenotype and drug resistance .
Author Kalitin,N.N., Kostyukova,M.N., Kakpakova,E.S., Tupitsyn,N.N. and Karamysheva,A.F.
Journal Bull. Exp. Biol. Med. 153 (6), 882-885 (2012)
Title Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis .
Author Jin,P., Zhang,J., Sumariwalla,P.F., Ni,I., Jorgensen,B., Crawford,D., Phillips,S., Feldmann,M., Shepard,H.M. and Paleolog,E.M.
Journal Arthritis Res. Ther. 10 (4), R73 (2008)
Title Expression of vascular endothelial growth factor and its receptors flt and KDR in ovarian carcinoma .
Author Boocock,C.A., Charnock-Jones,D.S., Sharkey,A.M., McLaren,J., Barker,P.J., Wright,K.A., Twentyman,P.R. and Smith,S.K.
Journal J. Natl. Cancer Inst. 87 (7), 506-516 (1995)
Title Inhibition of vascular endothelial cell growth factor activity by an endogenously encoded soluble receptor .
Author Kendall,R.L. and Thomas,K.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (22), 10705-10709 (1993)
Title The fms-like tyrosine kinase, a receptor for vascular endothelial growth factor .
Author de Vries,C., Escobedo,J.A., Ueno,H., Houck,K., Ferrara,N. and Williams,L.T.
Journal Science 255 (5047), 989-991 (1992)
Title Nucleotide sequence and expression of a novel human receptor-type tyrosine kinase gene (flt) closely related to the fms family .
Author Shibuya,M., Yamaguchi,S., Yamane,A., Ikeda,T., Tojo,A., Matsushime,H. and Sato,M.
Journal Oncogene 5 (4), 519-524 (1990)
Title Regional localization of the human c-ros-1 on 6q22 and flt on 13q12 .
Author Satoh,H., Yoshida,M.C., Matsushime,H., Shibuya,M. and Sasaki,M.
Journal Jpn. J. Cancer Res. 78 (8), 772-775 (1987)
Title A possible new member of tyrosine kinase family, human frt sequence, is highly conserved in vertebrates and located on human chromosome 13 .
Author Matsushime,H., Yoshida,M.C., Sasaki,M. and Shibuya,M.
Journal Jpn. J. Cancer Res. 78 (7), 655-661 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878