• THAT   AND
  • THAT   AND


Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002046 Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), mRNA. Full Lenth $379.90
ORF Sequence $292.32


RefSeq Version NM_002046.3, 83641890
Length 1310 bp
Structure linear
Update Date 01-MAY-2011
Organism Homo sapiens (human)
Definition Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), mRNA.
Product glyceraldehyde-3-phosphate dehydrogenase
Comment

Summary: The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq].

RefSeq NP_002037.2
CDS 103..1110
Exon (1)1..79
Exon (2)1..79
Exon (3)80..131
Exon (4)132..231
Exon (5)232..338
Exon (6)339..429
Exon (7)430..545
Exon (8)546..627
Exon (9)628..1040
Exon (10)1041..1310
Translation MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
21+c, tdbSNP:45571036
23+c, tdbSNP:45508900
47+a, gdbSNP:45568532
64+c, tdbSNP:3199979
65+c, tdbSNP:11549332
76..79+a, g, tdbSNP:11267039
84+g, tdbSNP:35318117
95+c, gdbSNP:11552253
95+c, gdbSNP:1136666
167+c, gdbSNP:45541435
188+a, gdbSNP:11549361
189+g, tdbSNP:11549342
208+c, gdbSNP:11549369
217+g, tdbSNP:11549328
280+g, tdbSNP:11549351
291+g, tdbSNP:11549346
297+g, tdbSNP:11549355
311+a, tdbSNP:11549358
315+a, gdbSNP:11549365
320+a, cdbSNP:11549367
325+a, gdbSNP:11549370
348+a, c, tdbSNP:11266264
350+c, tdbSNP:11549356
361+g, tdbSNP:113341953
366+c, tdbSNP:11549353
384+c, tdbSNP:11549324
398+c, tdbSNP:11549329
405+c, tdbSNP:11549337
408+c, tdbSNP:11549363
411+a, c, tdbSNP:11266742
420+a, gdbSNP:11549374
430+c, gdbSNP:11549323
432+c, tdbSNP:11549350
435+a, tdbSNP:11549322
446+c, g, tdbSNP:11549340
450+a, cdbSNP:11549349
476+c, tdbSNP:11549338
483+c, tdbSNP:1065691
498+c, tdbSNP:11549336
523+a, gdbSNP:74407849
560+c, tdbSNP:11549333
582+a, gdbSNP:11549366
583+g, tdbSNP:77154254
603+c, tdbSNP:11549330
604+c, tdbSNP:11549326
624+c, tdbSNP:11549343
698+c, gdbSNP:11549348
706..707+c, gdbSNP:11549352
730+c, tdbSNP:11549345
798+c, tdbSNP:11549347
810+a, cdbSNP:11549373
855+a, cdbSNP:1062429
complement(899)-g, adbSNP:11549316
905+c, gdbSNP:1065740
909+c, tdbSNP:1803623
910+c, tdbSNP:1062436
922+c, tdbSNP:3203507
930+a, cdbSNP:1062442
955+g, tdbSNP:1803619
983+c, tdbSNP:1803625
987+c, tdbSNP:1803621
990+c, tdbSNP:11549325
1029+g, tdbSNP:11549334
complement(1050)-g, adbSNP:1109
complement(1067)-t, adbSNP:11549321
1075+a, gdbSNP:1803624
1086+g, tdbSNP:3211600
1098+c, tdbSNP:11549371
1116+c, tdbSNP:3211592
1124+c, tdbSNP:11549320
1161+c, tdbSNP:111385796
1189+a, cdbSNP:11552252
complement(1195)-g, adbSNP:11549315
complement(1204)-g, adbSNP:11549319
1227+g, tdbSNP:1803622
1246+a, gdbSNP:3211598
1270+a, cdbSNP:3211599
Gene SymbolGAPDH
Gene SynonymG3PD; GAPD; MGC88685
Chromosome12
Locus Map12p13
All Transcripts NM_002046
Title p53 regulates biosynthesis through direct inactivation of glucose-6-phosphate dehydrogenase .
Author Jiang,P., Du,W., Wang,X., Mancuso,A., Gao,X., Wu,M. and Yang,X.
Journal Nat. Cell Biol. 13 (3), 310-316 (2011)
Title Binding of glyceraldehyde-3-phosphate dehydrogenase to the cis-acting element of structure-anchored repression in ccn2 mRNA .
Author Kondo,S., Kubota,S., Mukudai,Y., Nishida,T., Yoshihama,Y., Shirota,T., Shintani,S. and Takigawa,M.
Journal Biochem. Biophys. Res. Commun. 405 (3), 382-387 (2011)
Title Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study .
Author Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H., Schreiber,S. and Nebel,A.
Journal Mutat. Res. 694 (1-2), 13-19 (2010)
Title Association and heterogeneity at the GAPDH locus in Alzheimer's disease .
Author Allen,M., Cox,C., Belbin,O., Ma,L., Bisceglio,G.D., Wilcox,S.L., Howell,C.C., Hunter,T.A., Culley,O., Walker,L.P., Carrasquillo,M.M., Dickson,D.W., Petersen,R.C., Graff-Radford,N.R., Younkin,S.G. and Ertekin-Taner,N.
Journal Neurobiol. Aging (2010) In press
Title Identification of glyceraldehyde-3-phosphate dehydrogenase (GAPDH) as a binding protein for a 68-kDa Bacillus thuringiensis parasporal protein cytotoxic against leukaemic cells .
Author Krishnan,K., Ker,J.E., Mohammed,S.M. and Nadarajah,V.D.
Journal J. Biomed. Sci. 17, 86 (2010)
Title Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin .
Author Dawson,S.J. and White,L.A.
Journal J. Infect. 24 (3), 317-320 (1992)
Title A human nuclear uracil DNA glycosylase is the 37-kDa subunit of glyceraldehyde-3-phosphate dehydrogenase .
Author Meyer-Siegler,K., Mauro,D.J., Seal,G., Wurzer,J., deRiel,J.K. and Sirover,M.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (19), 8460-8464 (1991)
Title Characterization of the cell-cycle-regulated protein calcyclin from Ehrlich ascites tumor cells. Identification of two binding proteins obtained by Ca2(+)-dependent affinity chromatography .
Author Filipek,A., Gerke,V., Weber,K. and Kuznicki,J.
Journal Eur. J. Biochem. 195 (3), 795-800 (1991)
Title Twinning in crystals of human skeletal muscle D-glyceraldehyde-3-phosphate dehydrogenase .
Author Mercer,W.D., Winn,S.I. and Watson,H.C.
Journal J. Mol. Biol. 104 (1), 277-283 (1976)
Title The covalent structure of glyceraldehyde-phosphate dehydrogenase from human muscles. Isolation and amino acid sequences of peptides from tryptic digest .
Author Nowak,K., Kuczek,M., Ostropolska,L., Malarska,A., Wolny,M. and Baranowski,T.
Journal Hoppe-Seyler's Z. Physiol. Chem. 356 (7), 1181-1183 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878