• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002046 Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_002046.4, 378404906
Length 1401 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 1, mRNA.
Product glyceraldehyde-3-phosphate dehydrogenase isoform 1
Comment

Summary: The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_002037.2
CDS 175..1182
Misc Feature(1)178..618
Misc Feature(2)178..618
Misc Feature(3)178..180
Misc Feature(4)184..1179
Misc Feature(5)184..630
Misc Feature(6)187..189
Misc Feature(7)199..201
Misc Feature(8)298..300
Misc Feature(9)298..300
Misc Feature(10)355..357
Misc Feature(11)364..366
Misc Feature(12)370..372
Misc Feature(13)382..384
Misc Feature(14)397..399
Misc Feature(15)421..423
Misc Feature(16)421..423
Misc Feature(17)538..540
Misc Feature(18)616..618
Misc Feature(19)619..621
Misc Feature(20)625..633
Misc Feature(21)625..627
Misc Feature(22)order(628..630,640..642)
Misc Feature(23)628..630
Misc Feature(24)637..639
Misc Feature(25)643..1116
Misc Feature(26)709..711
Misc Feature(27)724..726
Misc Feature(28)754..756
Misc Feature(29)754..756
Misc Feature(30)754..756
Misc Feature(31)805..810
Misc Feature(32)805..807
Misc Feature(33)817..819
Misc Feature(34)817..819
Misc Feature(35)829..831
Misc Feature(36)847..849
Misc Feature(37)853..855
Misc Feature(38)853..855
Misc Feature(39)859..861
Misc Feature(40)883..885
Misc Feature(41)934..936
Misc Feature(42)952..954
Misc Feature(43)961..963
Misc Feature(44)1108..1110
Misc Feature(45)1120..1122
Misc Feature(46)1174..1176
Exon (1)1..151
Gene:GAPDH
Gene Synonym:G3PD; GAPD
Exon (2)152..203
Gene:GAPDH
Gene Synonym:G3PD; GAPD
Exon (3)204..303
Gene:GAPDH
Gene Synonym:G3PD; GAPD
Exon (4)304..410
Gene:GAPDH
Gene Synonym:G3PD; GAPD
Exon (5)411..501
Gene:GAPDH
Gene Synonym:G3PD; GAPD
Exon (6)502..617
Gene:GAPDH
Gene Synonym:G3PD; GAPD
Exon (7)618..699
Gene:GAPDH
Gene Synonym:G3PD; GAPD
Exon (8)700..1112
Gene:GAPDH
Gene Synonym:G3PD; GAPD
Exon (9)1113..1383
Gene:GAPDH
Gene Synonym:G3PD; GAPD
Translation MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
19+dbSNP:
19+c, gdbSNP:7307229
24..25+, gdbSNP:71450157
26+c, gdbSNP:112427350
35+c, tdbSNP:111720901
55+c, tdbSNP:45561238
93+c, tdbSNP:45571036
95+c, tdbSNP:45508900
119+a, gdbSNP:45568532
136+c, tdbSNP:3199979
137+c, tdbSNP:11549332
156+dbSNP:
156+g, tdbSNP:35318117
167..168+c, gdbSNP:11552253
167+c, gdbSNP:1136666
176+c, tdbSNP:147280944
234+a, gdbSNP:190547766
239+c, gdbSNP:45541435
260+a, gdbSNP:11549361
280+c, gdbSNP:11549369
282+c, tdbSNP:140793249
289+g, tdbSNP:11549328
297+c, gdbSNP:142283743
318+a, gdbSNP:151238733
326+a, cdbSNP:200102749
333+c, tdbSNP:139204528
352+a, g, tdbSNP:11549351
363+g, tdbSNP:11549346
366+c, tdbSNP:201939440
369+g, tdbSNP:11549355
383+a, gdbSNP:201368443
433+g, tdbSNP:113341953
438+c, tdbSNP:11549353
447+c, tdbSNP:200281741
456+c, tdbSNP:11549324
470+c, tdbSNP:11549329
475+a, gdbSNP:149945423
477+c, tdbSNP:11549337
480+c, tdbSNP:11549363
483+a, c, tdbSNP:11266742
492+a, gdbSNP:11549374
504+dbSNP:
504+c, tdbSNP:11549350
507+a, tdbSNP:11549322
518+c, g, tdbSNP:11549340
522+a, c, tdbSNP:11549349
548+c, tdbSNP:11549338
551+c, tdbSNP:146516445
555+c, tdbSNP:1065691
570+c, tdbSNP:11549336
576+c, tdbSNP:144761391
595+a, gdbSNP:74407849
610+a, gdbSNP:138863602
632+c, tdbSNP:11549333
655+g, tdbSNP:77154254
675+c, tdbSNP:11549330
676+c, tdbSNP:11549326
693+a, tdbSNP:201481859
694+a, cdbSNP:201208495
696+c, tdbSNP:11549343
770+c, gdbSNP:11549348
778..779+c, gdbSNP:11549352
802+c, tdbSNP:11549345
849+c, tdbSNP:148843886
870+c, tdbSNP:11549347
882+a, cdbSNP:11549373
891+c, tdbSNP:191738457
927+a, cdbSNP:1062429
971+a, gdbSNP:11549316
972+a, gdbSNP:200702058
977+c, gdbSNP:1065740
980+c, tdbSNP:143455013
981+c, tdbSNP:1803623
982+c, tdbSNP:1062436
994+c, tdbSNP:3203507
1002+a, cdbSNP:1062442
1027+g, tdbSNP:1803619
1038+c, tdbSNP:147970912
1050+c, tdbSNP:200251380
1055+c, tdbSNP:1803625
1059+c, tdbSNP:1803621
1062+c, tdbSNP:11549325
1074+c, tdbSNP:147124315
1080+c, tdbSNP:199746238
1083+c, tdbSNP:138528853
1101+g, tdbSNP:11549334
1122+dbSNP:
1122+a, gdbSNP:1109
1139+a, tdbSNP:11549321
1158+g, tdbSNP:3211600
1170+c, tdbSNP:11549371
1188+c, tdbSNP:3211592
1196+c, tdbSNP:11549320
1233+c, tdbSNP:111385796
1239+a, gdbSNP:138263904
1240+c, tdbSNP:192090590
1276+a, gdbSNP:11549319
1294+a, cdbSNP:141846451
1299+g, tdbSNP:1803622
1318+a, gdbSNP:3211598
1342+a, cdbSNP:3211599
1383+a, g, tdbSNP:112433978
Gene SymbolGAPDH
Gene SynonymG3PD; GAPD
Chromosome12
Locus Map12p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001256799 Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 2, mRNA. In-stock $348.00 $299.00 10
NM_002046 Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 1, mRNA. In-stock $418.00 $369.00 10
Title Human and pneumococcal cell surface glyceraldehyde-3-phosphate dehydrogenase (GAPDH) proteins are both ligands of human C1q protein .
Author Terrasse,R., Tacnet-Delorme,P., Moriscot,C., Perard,J., Schoehn,G., Vernet,T., Thielens,N.M., Di Guilmi,A.M. and Frachet,P.
Journal J. Biol. Chem. 287 (51), 42620-42633 (2012)
Title Heme binding properties of glyceraldehyde-3-phosphate dehydrogenase .
Author Hannibal,L., Collins,D., Brassard,J., Chakravarti,R., Vempati,R., Dorlet,P., Santolini,J., Dawson,J.H. and Stuehr,D.J.
Journal Biochemistry 51 (43), 8514-8529 (2012)
Title Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) induces cancer cell senescence by interacting with telomerase RNA component .
Author Nicholls,C., Pinto,A.R., Li,H., Li,L., Wang,L., Simpson,R. and Liu,J.P.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (33), 13308-13313 (2012)
Title Housekeeping gene selection advisory: glyceraldehyde-3-phosphate dehydrogenase (GAPDH) and beta-actin are targets of miR-644a .
Author Sikand,K., Singh,J., Ebron,J.S. and Shukla,G.C.
Journal PLoS ONE 7 (10), E47510 (2012)
Title Detection of human herpesvirus 8 by quantitative polymerase chain reaction: development and standardisation of methods .
Author Speicher,D.J. and Johnson,N.W.
Journal BMC Infect. Dis. 12, 210 (2012)
Title Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin .
Author Dawson,S.J. and White,L.A.
Journal J. Infect. 24 (3), 317-320 (1992)
Title A human nuclear uracil DNA glycosylase is the 37-kDa subunit of glyceraldehyde-3-phosphate dehydrogenase .
Author Meyer-Siegler,K., Mauro,D.J., Seal,G., Wurzer,J., deRiel,J.K. and Sirover,M.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (19), 8460-8464 (1991)
Title Characterization of the cell-cycle-regulated protein calcyclin from Ehrlich ascites tumor cells. Identification of two binding proteins obtained by Ca2(+)-dependent affinity chromatography .
Author Filipek,A., Gerke,V., Weber,K. and Kuznicki,J.
Journal Eur. J. Biochem. 195 (3), 795-800 (1991)
Title Twinning in crystals of human skeletal muscle D-glyceraldehyde-3-phosphate dehydrogenase .
Author Mercer,W.D., Winn,S.I. and Watson,H.C.
Journal J. Mol. Biol. 104 (1), 277-283 (1976)
Title The covalent structure of glyceraldehyde-phosphate dehydrogenase from human muscles. Isolation and amino acid sequences of peptides from tryptic digest .
Author Nowak,K., Kuczek,M., Ostropolska,L., Malarska,A., Wolny,M. and Baranowski,T.
Journal Hoppe-Seyler's Z. Physiol. Chem. 356 (7), 1181-1183 (1975)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.