• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20566 Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu20566C Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002046.5, 576583510
Length 1008 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens glyceraldehyde-3-phosphate dehydrogenase (GAPDH), transcript variant 1, mRNA.
Product glyceraldehyde-3-phosphate dehydrogenase isoform 1
Comment

Summary: This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The encoded protein has additionally been identified to have uracil DNA glycosylase activity in the nucleus. Studies of a similar protein in mouse have assigned a variety of additional functions including nitrosylation of nuclear proteins, the regulation of mRNA stability, and acting as a transferrin receptor on the cell surface of macrophage. Many pseudogenes similar to this locus are present in the human genome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_002037.2
CDS 189..1196
Misc Feature(1)192..632
Misc Feature(2)192..632
Misc Feature(3)195..1193
Misc Feature(4)198..644
Misc Feature(5)201..203
Misc Feature(6)213..215
Misc Feature(7)312..314
Misc Feature(8)312..314
Misc Feature(9)369..371
Misc Feature(10)378..380
Misc Feature(11)384..386
Misc Feature(12)396..398
Misc Feature(13)411..413
Misc Feature(14)435..437
Misc Feature(15)435..437
Misc Feature(16)552..554
Misc Feature(17)630..632
Misc Feature(18)633..635
Misc Feature(19)639..647
Misc Feature(20)639..641
Misc Feature(21)order(642..644,654..656)
Misc Feature(22)642..644
Misc Feature(23)651..653
Misc Feature(24)657..1130
Misc Feature(25)723..725
Misc Feature(26)738..740
Misc Feature(27)768..770
Misc Feature(28)768..770
Misc Feature(29)768..770
Misc Feature(30)819..824
Misc Feature(31)819..821
Misc Feature(32)831..833
Misc Feature(33)831..833
Misc Feature(34)843..845
Misc Feature(35)861..863
Misc Feature(36)867..869
Misc Feature(37)867..869
Misc Feature(38)873..875
Misc Feature(39)897..899
Misc Feature(40)948..950
Misc Feature(41)966..968
Misc Feature(42)975..977
Misc Feature(43)1122..1124
Misc Feature(44)1134..1136
Misc Feature(45)1188..1190
Exon (1)1..165
Gene:GAPDH
Gene Synonym:G3PD; GAPD; HEL-S-162eP
Exon (2)166..217
Gene:GAPDH
Gene Synonym:G3PD; GAPD; HEL-S-162eP
Exon (3)218..317
Gene:GAPDH
Gene Synonym:G3PD; GAPD; HEL-S-162eP
Exon (4)318..424
Gene:GAPDH
Gene Synonym:G3PD; GAPD; HEL-S-162eP
Exon (5)425..515
Gene:GAPDH
Gene Synonym:G3PD; GAPD; HEL-S-162eP
Exon (6)516..631
Gene:GAPDH
Gene Synonym:G3PD; GAPD; HEL-S-162eP
Exon (7)632..713
Gene:GAPDH
Gene Synonym:G3PD; GAPD; HEL-S-162eP
Exon (8)714..1126
Gene:GAPDH
Gene Synonym:G3PD; GAPD; HEL-S-162eP
Exon (9)1127..1401
Gene:GAPDH
Gene Synonym:G3PD; GAPD; HEL-S-162eP
Translation MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
33+dbSNP:
33+c, gdbSNP:7307229
40+c, gdbSNP:112427350
41..42+, gdbSNP:71450157
49+c, tdbSNP:111720901
69+c, tdbSNP:45561238
107+c, tdbSNP:45571036
109+c, tdbSNP:45508900
133+a, gdbSNP:45568532
143+c, tdbSNP:367946267
150+c, tdbSNP:3199979
151+c, tdbSNP:11549332
170+dbSNP:
170+g, tdbSNP:35318117
172+c, tdbSNP:372129246
181+c, gdbSNP:1136666
190+c, tdbSNP:147280944
198+a, gdbSNP:367765818
199+c, tdbSNP:369545182
203+c, gdbSNP:371408635
248+a, gdbSNP:190547766
253+c, gdbSNP:45541435
274+a, gdbSNP:11549361
285+a, gdbSNP:376494973
294+c, gdbSNP:11549369
296+c, tdbSNP:140793249
complement(303)-t, gdbSNP:11549328
311+c, gdbSNP:142283743
338+c, tdbSNP:377360455
340+a, cdbSNP:200102749
347+c, tdbSNP:139204528
366+a, g, tdbSNP:11549351
377+g, tdbSNP:11549346
380+c, tdbSNP:201939440
383+g, tdbSNP:11549355
397+a, gdbSNP:201368443
447+g, tdbSNP:113341953
452+c, tdbSNP:11549353
461+c, tdbSNP:200281741
470+c, tdbSNP:11549324
471+a, gdbSNP:371192512
484+c, tdbSNP:11549329
488+c, tdbSNP:371116598
489+a, gdbSNP:149945423
491+c, tdbSNP:11549337
494+c, tdbSNP:11549363
497+a, c, tdbSNP:11266742
503+c, gdbSNP:375963780
complement(506)-g, adbSNP:11549374
518+dbSNP:
518+c, tdbSNP:11549350
521+a, tdbSNP:11549322
532+c, g, tdbSNP:11549340
536+a, c, tdbSNP:11549349
560+c, gdbSNP:368740142
562+c, tdbSNP:11549338
565+c, tdbSNP:146516445
566+c, tdbSNP:370350073
569+c, tdbSNP:1065691
584+c, tdbSNP:11549336
590+c, tdbSNP:144761391
complement(609)-g, adbSNP:74407849
623+g, tdbSNP:372910824
624+a, gdbSNP:138863602
627+a, cdbSNP:376053895
646+c, tdbSNP:11549333
669+g, tdbSNP:77154254
689+c, tdbSNP:11549330
690+c, tdbSNP:11549326
707+a, tdbSNP:201481859
708+a, cdbSNP:201208495
710+c, tdbSNP:11549343
737+c, tdbSNP:369619209
764+c, tdbSNP:373252845
771+c, tdbSNP:376796183
784+c, gdbSNP:11549348
788+c, tdbSNP:368124080
792..793+c, gdbSNP:11549352
797+c, gdbSNP:372768955
815+c, tdbSNP:370741285
816+c, tdbSNP:11549345
863+c, tdbSNP:148843886
884..885+c, tdbSNP:11549347
896+a, cdbSNP:11549373
905+c, tdbSNP:191738457
941+a, cdbSNP:1062429
981+a, gdbSNP:377461105
complement(985)-g, adbSNP:11549316
986+a, gdbSNP:200702058
991+c, gdbSNP:1065740
994+c, tdbSNP:143455013
995+c, tdbSNP:1803623
996+c, tdbSNP:1062436
1005+a, gdbSNP:371787931
1008+c, tdbSNP:3203507
1016+a, cdbSNP:1062442
1041+g, tdbSNP:1803619
1052+c, tdbSNP:147970912
1064+c, tdbSNP:200251380
1069+c, tdbSNP:1803625
1073+c, tdbSNP:1803621
1076+c, tdbSNP:11549325
1088+c, tdbSNP:147124315
1094+c, tdbSNP:199746238
1097+c, tdbSNP:138528853
1099+a, gdbSNP:374950549
1115+g, tdbSNP:11549334
complement(1136)-dbSNP:
complement(1136)-g, adbSNP:1109
complement(1153)-t, adbSNP:11549321
1172+g, tdbSNP:3211600
1184+c, tdbSNP:11549371
1202+c, tdbSNP:3211592
1206+a, gdbSNP:371417284
1210+c, tdbSNP:11549320
1219+a, gdbSNP:376024489
1246+c, tdbSNP:373079410
1247+c, tdbSNP:111385796
1253+a, gdbSNP:138263904
1254+c, tdbSNP:192090590
complement(1290)-g, adbSNP:11549319
1308+a, cdbSNP:141846451
1313+g, tdbSNP:1803622
complement(1332)-g, adbSNP:3211598
1356+a, cdbSNP:3211599
1397+a, g, tdbSNP:112433978
Gene SymbolGAPDH
Gene SynonymG3PD; GAPD; HEL-S-162eP
Chromosome12
Locus Map12p13
Title Transglutaminase 2-dependent deamidation of glyceraldehyde-3-phosphate dehydrogenase promotes trophoblastic cell fusion .
Author Iwai K, Shibukawa Y, Yamazaki N and Wada Y.
Journal J. Biol. Chem. 289 (8), 4989-4999 (2014)
Title Glyceraldehyde-3-phosphate dehydrogenase is activated by lysine 254 acetylation in response to glucose signal .
Author Li T, Liu M, Feng X, Wang Z, Das I, Xu Y, Zhou X, Sun Y, Guan KL, Xiong Y and Lei QY.
Journal J. Biol. Chem. 289 (6), 3775-3785 (2014)
Title GAPDH binds to active Akt, leading to Bcl-xL increase and escape from caspase-independent cell death .
Author Jacquin MA, Chiche J, Zunino B, Beneteau M, Meynet O, Pradelli LA, Marchetti S, Cornille A, Carles M and Ricci JE.
Journal Cell Death Differ. 20 (8), 1043-1054 (2013)
Title The expression of glyceraldehyde-3-phosphate dehydrogenase associated cell cycle (GACC) genes correlates with cancer stage and poor survival in patients with solid tumors .
Author Wang D, Moothart DR, Lowy DR and Qian X.
Journal PLoS ONE 8 (4), E61262 (2013)
Title [Properties and functional diversity of glyceraldehyde-3-phosphate dehydrogenase] .
Author Rodacka A.
Journal Postepy Hig Med Dosw (Online) 67, 775-789 (2013)
Title The diverse functions of GAPDH: views from different subcellular compartments .
Author Tristan C, Shahani N, Sedlak TW and Sawa A.
Journal Cell. Signal. 23 (2), 317-323 (2011)
Title Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin .
Author Dawson SJ and White LA.
Journal J. Infect. 24 (3), 317-320 (1992)
Title A human nuclear uracil DNA glycosylase is the 37-kDa subunit of glyceraldehyde-3-phosphate dehydrogenase .
Author Meyer-Siegler K, Mauro DJ, Seal G, Wurzer J, deRiel JK and Sirover MA.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (19), 8460-8464 (1991)
Title Twinning in crystals of human skeletal muscle D-glyceraldehyde-3-phosphate dehydrogenase .
Author Mercer,W.D., Winn,S.I. and Watson,H.C.
Journal J. Mol. Biol. 104 (1), 277-283 (1976)
Title The covalent structure of glyceraldehyde-phosphate dehydrogenase from human muscles. Isolation and amino acid sequences of peptides from tryptic digest .
Author Nowak,K., Kuczek,M., Ostropolska,L., Malarska,A., Wolny,M. and Baranowski,T.
Journal Hoppe-Seyler's Z. Physiol. Chem. 356 (7), 1181-1183 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.