• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens GATA binding protein 3 (GATA3), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu26013 Homo sapiens GATA binding protein 3 (GATA3), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu26013C Homo sapiens GATA binding protein 3 (GATA3), transcript variant 2, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002051.2, 50541957
Length 1332 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens GATA binding protein 3 (GATA3), transcript variant 2, mRNA.
Product trans-acting T-cell-specific transcription factor GATA-3 isoform 2
Comment

Summary: This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. [provided by RefSeq, Nov 2009].


Transcript Variant: This variant (2) uses an alternate in-frame splice site in the mid-coding region, compared to variant 1, resulting in an isoform (2) that is 1 aa shorter than isoform 1.

RefSeq NP_002042.1
CDS 558..1889
Misc Feature(1)375..377
Misc Feature(2)900..902
Misc Feature(3)900..902
Misc Feature(4)1041..1043
Misc Feature(5)1341..1493
Misc Feature(6)order(1344..1346,1353..1355,1407..1409,1416..1418)
Misc Feature(7)order(1371..1376,1380..1382,1407..1439,1488..1490)
Misc Feature(8)1419..1505
Misc Feature(9)1503..1655
Misc Feature(10)order(1506..1508,1515..1517,1569..1571,1578..1580)
Misc Feature(11)order(1533..1538,1542..1544,1569..1601,1647..1649,
Misc Feature(12)1587..1616
Exon (1)1..188
Gene:GATA3
Gene Synonym:HDR; HDRS
Exon (2)189..798
Gene:GATA3
Gene Synonym:HDR; HDRS
Exon (3)799..1335
Gene:GATA3
Gene Synonym:HDR; HDRS
Exon (4)1336..1478
Gene:GATA3
Gene Synonym:HDR; HDRS
Exon (5)1479..1604
Gene:GATA3
Gene Synonym:HDR; HDRS
Exon (6)1605..3067
Gene:GATA3
Gene Synonym:HDR; HDRS
Translation MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT PMHPPSSLSFGPHHPSSMVTAMG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
41..42+dbSNP:
41..42+, aadbSNP:67829314
56..57+, a, aadbSNP:60098638
69..70+, gadbSNP:142178492
158+a, cdbSNP:185796020
199+dbSNP:
199+a, gdbSNP:138512915
207+c, tdbSNP:34628951
273+c, tdbSNP:368662863
294+g, tdbSNP:35971003
307+a, gdbSNP:10905277
421+a, cdbSNP:11567885
442+g, tdbSNP:76250826
451+a, cdbSNP:11567886
463+g, tdbSNP:369825935
489+a, gdbSNP:28395794
498+c, tdbSNP:11567887
500+c, tdbSNP:412359
509+c, tdbSNP:11567942
518+a, gdbSNP:201178566
complement(529)-t, cdbSNP:11540807
626+c, tdbSNP:138345596
629+a, gdbSNP:202168967
639+a, cdbSNP:202045701
745+a, gdbSNP:371853270
811+dbSNP:
811+a, gdbSNP:371992168
831+a, gdbSNP:142732425
840+c, gdbSNP:377637087
851+c, tdbSNP:144221016
854+c, tdbSNP:376569274
868..869+, cdbSNP:145573634
871+c, gdbSNP:78752986
874+a, cdbSNP:141062682
887+c, tdbSNP:111978415
888+c, gdbSNP:200765508
890+c, tdbSNP:369259048
932+c, tdbSNP:142451494
960+c, tdbSNP:150906764
981..982+, gdbSNP:36100495
983+a, gdbSNP:200317918
991+a, gdbSNP:373234853
1037+c, g, tdbSNP:143627754
1045+c, tdbSNP:201023943
1081+c, tdbSNP:34363744
1083+a, gdbSNP:201730759
1084+c, tdbSNP:145577748
1115+c, tdbSNP:375000813
1118+a, gdbSNP:191214710
1130+c, tdbSNP:35508267
1148+a, gdbSNP:372630189
1163+c, tdbSNP:2228254
1177..1178+a, cdbSNP:1778076
1178+c, tdbSNP:2229359
1196+a, gdbSNP:145459484
1259+c, tdbSNP:199565632
1263+c, tdbSNP:148835259
1264+c, gdbSNP:373442518
1265+c, tdbSNP:143582578
1281+a, gdbSNP:11567901
1287+c, gdbSNP:140982061
1289+c, tdbSNP:376009073
1299+a, gdbSNP:370055470
1307+a, gdbSNP:2228255
1377+dbSNP:
1377+a, tdbSNP:104894163
1379+a, gdbSNP:185672882
1383+c, tdbSNP:104894162
1394+c, gdbSNP:144796042
1403+c, tdbSNP:138698611
1424+a, gdbSNP:575091
1451+a, gdbSNP:200802269
1502+dbSNP:
1502+a, gdbSNP:12572959
1511+a, gdbSNP:142846560
1544+a, gdbSNP:374947324
1579+a, gdbSNP:387906621
1586+c, tdbSNP:104886017
1613+a, tdbSNP:104894165
1622+g, tdbSNP:201916439
1653+c, tdbSNP:104894164
1682+c, tdbSNP:372051101
1727+a, gdbSNP:150229374
1733+c, tdbSNP:138679257
1739+c, tdbSNP:149351039
1740+a, gdbSNP:200935603
1778+a, gdbSNP:144824106
1799+c, tdbSNP:200043087
complement(1803)-g, cdbSNP:35011589
1811+a, gdbSNP:11567941
1816+c, tdbSNP:374919553
1817+a, gdbSNP:369321512
1829+a, gdbSNP:182422967
1839+c, tdbSNP:201681929
1907+a, gdbSNP:372517287
1911+a, gdbSNP:199951165
1915+c, gdbSNP:200946839
1921+a, gdbSNP:377010406
1982+c, tdbSNP:2229360
2031+c, tdbSNP:104886030
2034..2035+, tdbSNP:35940385
2115+a, cdbSNP:373580523
2144..2145+, tdbSNP:3839918
2154..2155+, a, tdbSNP:58582188
2154+a, tdbSNP:112619514
2195+g, tdbSNP:12782127
2249+a, tdbSNP:11128
2272+g, tdbSNP:116910852
2345+a, gdbSNP:114528004
2380+a, gdbSNP:138815232
2395..2396+, adbSNP:201109271
2395+a, gdbSNP:201958150
2406+a, gdbSNP:9746
2487+a, gdbSNP:187150410
2501+a, gdbSNP:1058240
2553+c, tdbSNP:192494656
2555+c, tdbSNP:11540806
2590+c, tdbSNP:11540805
2677+a, gdbSNP:34808803
2876+g, tdbSNP:183890714
2881+a, tdbSNP:188497571
2906..2907+, cdbSNP:35075089
2950+c, tdbSNP:374600550
2955+c, tdbSNP:11255509
2971..2972+, cdbSNP:34352039
Gene SymbolGATA3
Gene SynonymHDR; HDRS
Chromosome10
Locus Map10p15
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002051 Homo sapiens GATA binding protein 3 (GATA3), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_001002295 Homo sapiens GATA binding protein 3 (GATA3), transcript variant 1, mRNA. On-demand $219.00 7-9
XM_005252442 PREDICTED: Homo sapiens GATA binding protein 3 (GATA3), transcript variant X1, mRNA. On-demand $219.00 7-9
XM_005252443 PREDICTED: Homo sapiens GATA binding protein 3 (GATA3), transcript variant X2, mRNA. On-demand $219.00 7-9
Title Genome-wide diet-gene interaction analyses for risk of colorectal cancer .
Author Figueiredo JC, Hsu L, Hutter CM, Lin Y, Campbell PT, Baron JA, Berndt SI, Jiao S, Casey G, Fortini B, Chan AT, Cotterchio M, Lemire M, Gallinger S, Harrison TA, Le Marchand L, Newcomb PA, Slattery ML, Caan BJ, Carlson CS, Zanke BW, Rosse SA, Brenner H, Giovannucci EL, Wu K, Chang-Claude J, Chanock SJ, Curtis KR, Duggan D, Gong J, Haile RW, Hayes RB, Hoffmeister M, Hopper JL, Jenkins MA, Kolonel LN, Qu C, Rudolph A, Schoen RE, Schumacher FR, Seminara D, Stelling DL, Thibodeau SN, Thornquist M, Warnick GS, Henderson BE, Ulrich CM, Gauderman WJ, Potter JD, White E and Peters U.
Journal PLoS Genet. 10 (4), E1004228 (2014)
Title Comprehensive profile of GATA binding protein 3 immunohistochemical expression in primary and metastatic renal neoplasms .
Author Gonzalez-Roibon N, Faraj SF, Munari E, Bezerra SM, Albadine R, Sharma R, Argani P, Allaf ME and Netto GJ.
Journal Hum. Pathol. 45 (2), 244-248 (2014)
Title Research on the roles of transcription factors T-bet and GATA-3 in aplastic anemia .
Author Chen,H., Luo,Z., Shen,H., Ren,C., Li,Z., Tang,J., Wang,J. and Wu,T.
Journal Clin. Lab. 60 (2), 291-295 (2014)
Title GATA3 transcription factor abrogates Smad4 transcription factor-mediated fascin overexpression, invadopodium formation, and breast cancer cell invasion .
Author Sun J, He H, Pillai S, Xiong Y, Challa S, Xu L, Chellappan S and Yang S.
Journal J. Biol. Chem. 288 (52), 36971-36982 (2013)
Title Variation at 3p24.1 and 6q23.3 influences the risk of Hodgkin's lymphoma .
Author Frampton M, da Silva Filho MI, Broderick P, Thomsen H, Forsti A, Vijayakrishnan J, Cooke R, Enciso-Mora V, Hoffmann P, Nothen MM, Lloyd A, Holroyd A, Eisele L, Jockel KH, Ponader S, von Strandmann EP, Lightfoot T, Roman E, Lake A, Montgomery D, Jarrett RF, Swerdlow AJ, Engert A, Hemminki K and Houlston RS.
Journal Nat Commun 4, 2549 (2013)
Title Activation of the interleukin-5 promoter by cAMP in murine EL-4 cells requires the GATA-3 and CLE0 elements .
Author Siegel MD, Zhang DH, Ray P and Ray A.
Journal J. Biol. Chem. 270 (41), 24548-24555 (1995)
Title The human enhancer-binding protein Gata3 binds to several T-cell receptor regulatory elements .
Author Marine J and Winoto A.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (16), 7284-7288 (1991)
Title A T-cell specific TCR delta DNA binding protein is a member of the human GATA family .
Author Joulin V, Bories D, Eleouet JF, Labastie MC, Chretien S, Mattei MG and Romeo PH.
Journal EMBO J. 10 (7), 1809-1816 (1991)
Title Murine and human T-lymphocyte GATA-3 factors mediate transcription through a cis-regulatory element within the human T-cell receptor delta gene enhancer .
Author Ko LJ, Yamamoto M, Leonard MW, George KM, Ting P and Engel JD.
Journal Mol. Cell. Biol. 11 (5), 2778-2784 (1991)
Title Human GATA-3: a lineage-restricted transcription factor that regulates the expression of the T cell receptor alpha gene .
Author Ho IC, Vorhees P, Marin N, Oakley BK, Tsai SF, Orkin SH and Leiden JM.
Journal EMBO J. 10 (5), 1187-1192 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.