• THAT   AND
  • THAT   AND


Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002070 Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mRNA. Full Lenth $638.00
ORF Sequence $309.72


RefSeq Version NM_002070.2, 49574535
Length 2200 bp
Structure linear
Update Date 12-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mRNA.
Product guanine nucleotide-binding protein G(i) subunit alpha-2 isoform 1
Comment

Summary: The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been detected for this gene, but the full-length nature of only two are known so far. [provided by RefSeq].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_002061.1
CDS 122..1189
Exon (1)1..239
Exon (2)1..239
Exon (3)240..282
Exon (4)283..424
Exon (5)425..585
Exon (6)586..714
Exon (7)715..844
Exon (8)845..998
Exon (9)999..1213
Exon (10)1214..2200
Translation MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
99+a, cdbSNP:34944516
111+c, tdbSNP:11557220
246+g, tdbSNP:17851218
283+, gdbSNP:67167491
complement(307)-g, adbSNP:762707
372+, tdbSNP:67741912
388+a, cdbSNP:1050067
423+c, tdbSNP:112497464
457+c, tdbSNP:115287046
656+c, g, tdbSNP:137853226
657+a, gdbSNP:137853227
721+a, tdbSNP:137853228
841+a, gdbSNP:11557219
848+c, tdbSNP:12721535
979+a, cdbSNP:77643206
1103..1104+, cdbSNP:35326130
1160..1161+, adbSNP:66539739
1162..1163+, adbSNP:67090277
1226+c, tdbSNP:76737154
1351+a, cdbSNP:116369548
1485+g, tdbSNP:113343486
1486+g, tdbSNP:12813
1564+c, tdbSNP:115699651
1738+a, gdbSNP:3209953
1739+a, tdbSNP:3209954
1744+a, gdbSNP:76340684
1745..1746+, adbSNP:71802167
1754+, adbSNP:71688940
1756..1757+, adbSNP:71728346
complement(1888)-g, adbSNP:12895
2127..2128+, cdbSNP:34342188
complement(2140)-g, adbSNP:15488
Gene SymbolGNAI2
Gene SynonymGIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Chromosome3
Locus Map3p21
All Transcripts NM_002070 , NM_001166425
Title Identification and experimental validation of G protein alpha inhibiting activity polypeptide 2 (GNAI2) as a microRNA-138 target in tongue squamous cell carcinoma .
Author Jiang,L., Dai,Y., Liu,X., Wang,C., Wang,A., Chen,Z., Heidbreder,C.E., Kolokythas,A. and Zhou,X.
Journal Hum. Genet. 129 (2), 189-197 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population .
Author So,H.C., Fong,P.Y., Chen,R.Y., Hui,T.C., Ng,M.Y., Cherny,S.S., Mak,W.W., Cheung,E.F., Chan,R.C., Chen,E.Y., Li,T. and Sham,P.C.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 153B (1), 103-113 (2010)
Title Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip .
Author Talmud,P.J., Drenos,F., Shah,S., Shah,T., Palmen,J., Verzilli,C., Gaunt,T.R., Pallas,J., Lovering,R., Li,K., Casas,J.P., Sofat,R., Kumari,M., Rodriguez,S., Johnson,T., Newhouse,S.J., Dominiczak,A., Samani,N.J., Caulfield,M., Sever,P., Stanton,A., Shields,D.C., Padmanabhan,S., Melander,O., Hastie,C., Delles,C., Ebrahim,S., Marmot,M.G., Smith,G.D., Lawlor,D.A., Munroe,P.B., Day,I.N., Kivimaki,M., Whittaker,J., Humphries,S.E. and Hingorani,A.D.
Journal Am. J. Hum. Genet. 85 (5), 628-642 (2009)
Title Purification and functional reconstitution of monomeric mu-opioid receptors: allosteric modulation of agonist binding by Gi2 .
Author Kuszak,A.J., Pitchiaya,S., Anand,J.P., Mosberg,H.I., Walter,N.G. and Sunahara,R.K.
Journal J. Biol. Chem. 284 (39), 26732-26741 (2009)
Title Regional localization of the human G protein alpha i2 (GNAI2) gene: assignment to 3p21 and a related sequence (GNAI2L) to 12p12-p13 .
Author Magovcevic,I., Ang,S.L., Seidman,J.G., Tolman,C.J., Neer,E.J. and Morton,C.C.
Journal Genomics 12 (1), 125-129 (1992)
Title Identification of G protein alpha-subunits in RINm5F cells and their selective interaction with galanin receptor .
Author Cormont,M., Le Marchand-Brustel,Y., Van Obberghen,E., Spiegel,A.M. and Sharp,G.W.
Journal Diabetes 40 (9), 1170-1176 (1991)
Title Evidence for opioid receptor-mediated activation of the G-proteins, Go and Gi2, in membranes of neuroblastoma x glioma (NG108-15) hybrid cells .
Author Offermanns,S., Schultz,G. and Rosenthal,W.
Journal J. Biol. Chem. 266 (6), 3365-3368 (1991)
Title Two G protein oncogenes in human endocrine tumors .
Author Lyons,J., Landis,C.A., Harsh,G., Vallar,L., Grunewald,K., Feichtinger,H., Duh,Q.Y., Clark,O.H., Kawasaki,E., Bourne,H.R. et al.
Journal Science 249 (4969), 655-659 (1990)
Title Hormonal regulation of Gi2 alpha-subunit phosphorylation in intact hepatocytes .
Author Bushfield,M., Murphy,G.J., Lavan,B.E., Parker,P.J., Hruby,V.J., Milligan,G. and Houslay,M.D.
Journal Biochem. J. 268 (2), 449-457 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878