• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002070 Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_002070.3, 543583771
Length 2258 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mRNA.
Product guanine nucleotide-binding protein G(i) subunit alpha-2 isoform 1
Comment

Summary: The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013].


Transcript Variant: This variant (1) encodes the longest isoform (1).

RefSeq NP_002061.1
CDS 180..1247
Misc Feature(1)216..1238
Misc Feature(2)216..1238
Misc Feature(3)279..1226
Misc Feature(4)order(297..299,312..320,723..725,780..782,789..791,
Misc Feature(5)297..320
Misc Feature(6)order(300..308,390..392,402..404,414..416,423..425,
Misc Feature(7)384..386
Misc Feature(8)708..734
Misc Feature(9)723..725
Misc Feature(10)order(726..728,732..734,738..740,771..773,777..779,
Misc Feature(11)order(732..734,807..809,816..821,828..830)
Misc Feature(12)780..791
Misc Feature(13)783..833
Misc Feature(14)987..998
Misc Feature(15)order(1131..1166,1170..1181)
Misc Feature(16)1155..1163
Exon (1)1..297
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (2)298..340
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (3)341..482
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (4)483..643
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (5)644..772
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (6)773..902
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (7)903..1056
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (8)1057..1271
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (9)1272..2258
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Translation MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
157+dbSNP:
157+a, cdbSNP:34944516
169+c, tdbSNP:11557220
192+g, tdbSNP:143760938
304+dbSNP:
304+g, tdbSNP:17851218
350+dbSNP:
350+c, tdbSNP:138495790
365+a, gdbSNP:762707
365+c, tdbSNP:386612064
391+a, cdbSNP:138213627
446+a, cdbSNP:1050067
459+a, gdbSNP:183955200
480+a, gdbSNP:149596343
481+c, tdbSNP:112497464
515+dbSNP:
515+c, tdbSNP:115287046
519+a, gdbSNP:368004918
521+c, tdbSNP:146259462
532+a, gdbSNP:371969824
534+a, gdbSNP:150943193
554+c, tdbSNP:373705209
556+g, tdbSNP:140764270
557+c, tdbSNP:142508788
558+a, gdbSNP:200441316
564+c, tdbSNP:180852414
617+a, gdbSNP:367617983
626+c, tdbSNP:372356382
647+dbSNP:
647+c, tdbSNP:367669032
653+c, tdbSNP:199645073
714+c, g, tdbSNP:137853226
715+a, gdbSNP:137853227
716+c, tdbSNP:146768972
761+c, tdbSNP:149019479
779+dbSNP:
779+a, tdbSNP:137853228
800+c, tdbSNP:369101180
803+a, gdbSNP:373500446
833+c, tdbSNP:141848616
839+a, gdbSNP:201958549
851+c, tdbSNP:143353731
854+c, tdbSNP:141703681
855+a, gdbSNP:376430681
893+c, tdbSNP:138946270
899+a, gdbSNP:11557219
905+dbSNP:
905+c, tdbSNP:267599879
906+c, tdbSNP:12721535
1028+c, tdbSNP:139197363
1029+c, tdbSNP:142945610
1037+a, cdbSNP:77643206
1058+dbSNP:
1058+a, gdbSNP:143863348
1061+a, cdbSNP:375264138
1070+c, tdbSNP:368550765
1129+c, gdbSNP:372568318
1145+a, gdbSNP:377114196
1154+g, tdbSNP:147785481
1161..1162+, cdbSNP:35326130
1176+a, gdbSNP:139567497
1202+c, tdbSNP:147937896
1251+g, tdbSNP:200506702
1265+c, tdbSNP:370947414
1284+c, tdbSNP:76737154
1330+a, gdbSNP:374572856
1409+a, cdbSNP:116369548
complement(1419)-g, adbSNP:137909745
1543+g, tdbSNP:113343486
1544+g, tdbSNP:12813
1622+c, tdbSNP:115699651
1692+c, tdbSNP:183872438
1706+a, cdbSNP:188823486
1727+a, gdbSNP:192924654
1796+a, gdbSNP:3209953
1797+a, tdbSNP:3209954
1801+a, gdbSNP:199935816
1801+, gdbSNP:146158517
1802+a, gdbSNP:76340684
1860+c, tdbSNP:368304611
complement(1946)-g, adbSNP:12895
1946+c, tdbSNP:386526454
2185..2186+, cdbSNP:34342188
2198+a, gdbSNP:386537039
complement(2198)-g, adbSNP:15488
Title Galphai2 signaling is required for skeletal muscle growth, regeneration, and satellite cell proliferation and differentiation .
Author Minetti GC, Feige JN, Bombard F, Heier A, Morvan F, Nurnberg B, Leiss V, Birnbaumer L, Glass DJ and Fornaro M.
Journal Mol. Cell. Biol. 34 (4), 619-630 (2014)
Title Ubiquitination of the heterotrimeric G protein alpha subunits Galphai2 and Galphaq is prevented by the guanine nucleotide exchange factor Ric-8A .
Author Chishiki K, Kamakura S, Yuzawa S, Hayase J and Sumimoto H.
Journal Biochem. Biophys. Res. Commun. 435 (3), 414-419 (2013)
Title Increased Gsalpha within blood cell membrane lipid microdomains in some depressive disorders: an exploratory study .
Author Mooney JJ, Samson JA, McHale NL, Pappalarado KM, Alpert JE and Schildkraut JJ.
Journal J Psychiatr Res 47 (6), 706-711 (2013)
Title The familial hemiplegic migraine type 1 mutation K1336E affects direct G protein-mediated regulation of neuronal P/Q-type Ca2+ channels .
Author Garza-Lopez E, Gonzalez-Ramirez R, Gandini MA, Sandoval A and Felix R.
Journal Cephalalgia 33 (6), 398-407 (2013)
Title HIV-1 Nef impairs heterotrimeric G-protein signaling by targeting Galpha(i2) for degradation through ubiquitination .
Author Chandrasekaran P, Buckley M, Moore V, Wang LQ, Kehrl JH and Venkatesan S.
Journal J. Biol. Chem. 287 (49), 41481-41498 (2012)
Title Regional localization of the human G protein alpha i2 (GNAI2) gene: assignment to 3p21 and a related sequence (GNAI2L) to 12p12-p13 .
Author Magovcevic I, Ang SL, Seidman JG, Tolman CJ, Neer EJ and Morton CC.
Journal Genomics 12 (1), 125-129 (1992)
Title Identification of G protein alpha-subunits in RINm5F cells and their selective interaction with galanin receptor .
Author Cormont M, Le Marchand-Brustel Y, Van Obberghen E, Spiegel AM and Sharp GW.
Journal Diabetes 40 (9), 1170-1176 (1991)
Title Evidence for opioid receptor-mediated activation of the G-proteins, Go and Gi2, in membranes of neuroblastoma x glioma (NG108-15) hybrid cells .
Author Offermanns S, Schultz G and Rosenthal W.
Journal J. Biol. Chem. 266 (6), 3365-3368 (1991)
Title Two G protein oncogenes in human endocrine tumors .
Author Lyons J, Landis CA, Harsh G, Vallar L, Grunewald K, Feichtinger H, Duh QY, Clark OH, Kawasaki E and Bourne HR.
Journal Science 249 (4969), 655-659 (1990)
Title Hormonal regulation of Gi2 alpha-subunit phosphorylation in intact hepatocytes .
Author Bushfield M, Murphy GJ, Lavan BE, Parker PJ, Hruby VJ, Milligan G and Houslay MD.
Journal Biochem. J. 268 (2), 449-457 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.