• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002070 Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_002070.2, 49574535
Length 2200 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mRNA.
Product guanine nucleotide-binding protein G(i) subunit alpha-2 isoform 1
Comment

Summary: The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been detected for this gene, but the full-length nature of only two are known so far. [provided by RefSeq, Oct 2009].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_002061.1
CDS 122..1189
Misc Feature(1)158..1180
Misc Feature(2)158..1180
Misc Feature(3)221..1168
Misc Feature(4)order(239..241,254..262,665..667,722..724,731..733,
Misc Feature(5)239..262
Misc Feature(6)order(242..250,332..334,344..346,356..358,365..367,
Misc Feature(7)326..328
Misc Feature(8)650..676
Misc Feature(9)665..667
Misc Feature(10)order(668..670,674..676,680..682,713..715,719..721,
Misc Feature(11)order(674..676,749..751,758..763,770..772)
Misc Feature(12)722..733
Misc Feature(13)725..775
Misc Feature(14)929..940
Misc Feature(15)order(1073..1108,1112..1123)
Misc Feature(16)1097..1105
Exon (1)1..239
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (2)240..282
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (3)283..424
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (4)425..585
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (5)586..714
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (6)715..844
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (7)845..998
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (8)999..1213
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Exon (9)1214..2200
Gene:GNAI2
Gene Synonym:GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Translation MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
99+dbSNP:
99+a, cdbSNP:34944516
111+c, tdbSNP:11557220
134+g, tdbSNP:143760938
246+dbSNP:
246+g, tdbSNP:17851218
292+dbSNP:
292+c, tdbSNP:138495790
307+a, gdbSNP:762707
333+a, cdbSNP:138213627
372+, tdbSNP:67741912
388+a, cdbSNP:1050067
401+a, gdbSNP:183955200
422+a, gdbSNP:149596343
423+c, tdbSNP:112497464
457+dbSNP:
457+c, tdbSNP:115287046
463+c, tdbSNP:146259462
476+a, gdbSNP:150943193
498+g, tdbSNP:140764270
499+c, tdbSNP:142508788
500+a, gdbSNP:200441316
506+c, tdbSNP:180852414
595+dbSNP:
595+c, tdbSNP:199645073
656+c, g, tdbSNP:137853226
657+a, gdbSNP:137853227
658+c, tdbSNP:146768972
703+c, tdbSNP:149019479
721+dbSNP:
721+a, tdbSNP:137853228
775+c, tdbSNP:141848616
781+a, gdbSNP:201958549
793+c, tdbSNP:143353731
796+c, tdbSNP:141703681
835+c, tdbSNP:138946270
841+a, gdbSNP:11557219
848+dbSNP:
848+c, tdbSNP:12721535
970+c, tdbSNP:139197363
971+c, tdbSNP:142945610
979+a, cdbSNP:77643206
1000+dbSNP:
1000+a, gdbSNP:143863348
1096+g, tdbSNP:147785481
1101..1102+, cdbSNP:35326130
1118+a, gdbSNP:139567497
1144+c, tdbSNP:147937896
1160..1161+, adbSNP:66539739
1193+g, tdbSNP:200506702
1226+c, tdbSNP:76737154
1351+a, cdbSNP:116369548
1361+a, gdbSNP:137909745
1485+g, tdbSNP:113343486
1486+g, tdbSNP:12813
1564+c, tdbSNP:115699651
1634+c, tdbSNP:183872438
1648+a, cdbSNP:188823486
1669+a, gdbSNP:192924654
1738+a, gdbSNP:3209953
1739+a, tdbSNP:3209954
1743+a, gdbSNP:199935816
1743+, gdbSNP:146158517
1744+a, gdbSNP:76340684
1745..1746+, adbSNP:71728346
1745+, adbSNP:71688940
1888+a, gdbSNP:12895
2127..2128+, cdbSNP:34342188
2140+a, gdbSNP:15488
Gene SymbolGNAI2
Gene SynonymGIP; GNAI2B; H_LUCA15.1; H_LUCA16.1
Chromosome3
Locus Map3p21.31
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001166425 Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 2, mRNA. On-demand $549.00 14
NM_002070 Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mRNA. In-stock $418.00 $369.00 10
Title HIV-1 Nef impairs heterotrimeric G-protein signaling by targeting Galpha(i2) for degradation through ubiquitination .
Author Chandrasekaran,P., Buckley,M., Moore,V., Wang,L.Q., Kehrl,J.H. and Venkatesan,S.
Journal J. Biol. Chem. 287 (49), 41481-41498 (2012)
Title The essential role of Gialpha2 in prostate cancer cell migration .
Author Zhong,M., Clarke,S., Vo,B.T. and Khan,S.A.
Journal Mol. Cancer Res. 10 (10), 1380-1388 (2012)
Title Guanine nucleotide-binding protein Galphai2: a new partner of claudin-5 that regulates tight junction integrity in human brain endothelial cells .
Author Luissint,A.C., Federici,C., Guillonneau,F., Chretien,F., Camoin,L., Glacial,F., Ganeshamoorthy,K. and Couraud,P.O.
Journal J. Cereb. Blood Flow Metab. 32 (5), 860-873 (2012)
Title Heterotrimeric Gi/Go proteins modulate endothelial TLR signaling independent of the MyD88-dependent pathway .
Author Dauphinee,S.M., Voelcker,V., Tebaykina,Z., Wong,F. and Karsan,A.
Journal Am. J. Physiol. Heart Circ. Physiol. 301 (6), H2246-H2253 (2011)
Title G alpha i2 and ZAP-70 mediate RasGRP1 membrane localization and activation of SDF-1-induced T cell functions .
Author Kremer,K.N., Kumar,A. and Hedin,K.E.
Journal J. Immunol. 187 (6), 3177-3185 (2011)
Title Regional localization of the human G protein alpha i2 (GNAI2) gene: assignment to 3p21 and a related sequence (GNAI2L) to 12p12-p13 .
Author Magovcevic,I., Ang,S.L., Seidman,J.G., Tolman,C.J., Neer,E.J. and Morton,C.C.
Journal Genomics 12 (1), 125-129 (1992)
Title Identification of G protein alpha-subunits in RINm5F cells and their selective interaction with galanin receptor .
Author Cormont,M., Le Marchand-Brustel,Y., Van Obberghen,E., Spiegel,A.M. and Sharp,G.W.
Journal Diabetes 40 (9), 1170-1176 (1991)
Title Evidence for opioid receptor-mediated activation of the G-proteins, Go and Gi2, in membranes of neuroblastoma x glioma (NG108-15) hybrid cells .
Author Offermanns,S., Schultz,G. and Rosenthal,W.
Journal J. Biol. Chem. 266 (6), 3365-3368 (1991)
Title Two G protein oncogenes in human endocrine tumors .
Author Lyons,J., Landis,C.A., Harsh,G., Vallar,L., Grunewald,K., Feichtinger,H., Duh,Q.Y., Clark,O.H., Kawasaki,E., Bourne,H.R. et al.
Journal Science 249 (4969), 655-659 (1990)
Title Hormonal regulation of Gi2 alpha-subunit phosphorylation in intact hepatocytes .
Author Bushfield,M., Murphy,G.J., Lavan,B.E., Parker,P.J., Hruby,V.J., Milligan,G. and Houslay,M.D.
Journal Biochem. J. 268 (2), 449-457 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.