• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glutathione peroxidase 3 (plasma) (GPX3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002084 Homo sapiens glutathione peroxidase 3 (plasma) (GPX3), mRNA. GenEZ ORF Cloning In-stock $308.00 $259.00 10

*Business Day

Related Services

RefSeq Version NM_002084.3, 89903006
Length 1779 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens glutathione peroxidase 3 (plasma) (GPX3), mRNA.
Product glutathione peroxidase 3 precursor
Comment

Summary: This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq, Jul 2008].

RefSeq NP_002075.2
CDS 218..898
Misc Feature(1)197..199
Misc Feature(2)332..850
Misc Feature(3)order(434..436,536..538,758..760)
Misc Feature(4)434..436
Misc Feature(5)order(533..535,542..544,548..550,557..559,566..568,
Exon (1)1..304
Gene:GPX3
Gene Synonym:GPx-P; GSHPx-3; GSHPx-P
Exon (2)305..458
Gene:GPX3
Gene Synonym:GPx-P; GSHPx-3; GSHPx-P
Exon (3)459..576
Gene:GPX3
Gene Synonym:GPx-P; GSHPx-3; GSHPx-P
Exon (4)577..676
Gene:GPX3
Gene Synonym:GPx-P; GSHPx-3; GSHPx-P
Exon (5)677..1761
Gene:GPX3
Gene Synonym:GPx-P; GSHPx-3; GSHPx-P
Translation MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYA GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIR WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
84+dbSNP:
84+c, gdbSNP:8177411
89+c, tdbSNP:8177412
256+c, gdbSNP:8177413
341+dbSNP:
341+a, gdbSNP:200128541
421+c, tdbSNP:142849792
445+a, gdbSNP:200228989
500+dbSNP:
500+a, gdbSNP:200221775
541+a, gdbSNP:200416261
599+dbSNP:
599+c, tdbSNP:8177445
621+g, tdbSNP:201249129
647+a, tdbSNP:11544082
683+dbSNP:
683+c, tdbSNP:200470998
734+c, tdbSNP:184186742
900+g, tdbSNP:200511585
901+a, gdbSNP:200721773
965+c, tdbSNP:1803677
971+c, tdbSNP:188838205
990+c, tdbSNP:11548
995+c, tdbSNP:150488167
1036+g, tdbSNP:2230303
1059+a, gdbSNP:7722386
1142+a, gdbSNP:8177448
1146+c, tdbSNP:8177449
1147+a, gdbSNP:2070593
1153+a, gdbSNP:8177450
1154+c, tdbSNP:8177451
1279+a, gdbSNP:192433815
1302+a, gdbSNP:79250800
1407+a, c, tdbSNP:1064506
1422+a, cdbSNP:143049264
1459..1460+, ccdbSNP:71671049
1506+a, gdbSNP:8177452
1522+c, tdbSNP:4661
1536+c, gdbSNP:17111673
1555+c, tdbSNP:138719981
1611+c, tdbSNP:1059316
1640+a, cdbSNP:8177453
1646+, ccdbSNP:71795450
1728+a, gdbSNP:187389496
Gene SymbolGPX3
Gene SynonymGPx-P; GSHPx-3; GSHPx-P
Chromosome5
Locus Map5q23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002084 Homo sapiens glutathione peroxidase 3 (plasma) (GPX3), mRNA. In-stock $308.00 $259.00 10
Title p53-induced gene 3 mediates cell death induced by glutathione peroxidase 3 .
Author Wang,H., Luo,K., Tan,L.Z., Ren,B.G., Gu,L.Q., Michalopoulos,G., Luo,J.H. and Yu,Y.P.
Journal J. Biol. Chem. 287 (20), 16890-16902 (2012)
Title A role for GPx3 in activity of normal and leukemia stem cells .
Author Herault,O., Hope,K.J., Deneault,E., Mayotte,N., Chagraoui,J., Wilhelm,B.T., Cellot,S., Sauvageau,M., Andrade-Navarro,M.A., Hebert,J. and Sauvageau,G.
Journal J. Exp. Med. 209 (5), 895-901 (2012)
Title Silencing of glutathione peroxidase 3 through DNA hypermethylation is associated with lymph node metastasis in gastric carcinomas .
Author Peng,D.F., Hu,T.L., Schneider,B.G., Chen,Z., Xu,Z.K. and El-Rifai,W.
Journal PLoS ONE 7 (10), E46214 (2012)
Title GPx3 promoter hypermethylation is a frequent event in human cancer and is associated with tumorigenesis and chemotherapy response .
Author Chen,B., Rao,X., House,M.G., Nephew,K.P., Cullen,K.J. and Guo,Z.
Journal Cancer Lett. 309 (1), 37-45 (2011)
Title Association of tag SNPs of GPx-3 with essential hypertension in rural Han Chinese in Fuxin, Liaoning, China .
Author Hao,Y., Wu,B.G., Shi,J., Chen,Y.L., Sun,Z.Q., Zheng,L.Q., Zhang,X.G., Geng,N., Li,T.J., Li,H. and Sun,Y.X.
Journal Chin. Med. J. 124 (14), 2113-2116 (2011)
Title Expression of plasma glutathione peroxidase in human liver in addition to kidney, heart, lung, and breast in humans and rodents .
Author Chu,F.F., Esworthy,R.S., Doroshow,J.H., Doan,K. and Liu,X.F.
Journal Blood 79 (12), 3233-3238 (1992)
Title Characterization and partial amino acid sequence of human plasma glutathione peroxidase .
Author Esworthy,R.S., Chu,F.F., Paxton,R.J., Akman,S. and Doroshow,J.H.
Journal Arch. Biochem. Biophys. 286 (2), 330-336 (1991)
Title Primary structure of human plasma glutathione peroxidase deduced from cDNA sequences .
Author Takahashi,K., Akasaka,M., Yamamoto,Y., Kobayashi,C., Mizoguchi,J. and Koyama,J.
Journal J. Biochem. 108 (2), 145-148 (1990)
Title Antihuman plasma glutathione peroxidase antibodies: immunologic investigations to determine plasma glutathione peroxidase protein and selenium content in plasma .
Author Avissar,N., Whitin,J.C., Allen,P.Z., Palmer,I.S. and Cohen,H.J.
Journal Blood 73 (1), 318-323 (1989)
Title Purification and characterization of human plasma glutathione peroxidase: a selenoglycoprotein distinct from the known cellular enzyme .
Author Takahashi,K., Avissar,N., Whitin,J. and Cohen,H.
Journal Arch. Biochem. Biophys. 256 (2), 677-686 (1987)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.