• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glutathione peroxidase 3 (plasma) (GPX3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu14624 Homo sapiens glutathione peroxidase 3 (plasma) (GPX3), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu14624C Homo sapiens glutathione peroxidase 3 (plasma) (GPX3), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002084.3, 89903006
Length 681 bp
Structure linear
Update Date 05-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens glutathione peroxidase 3 (plasma) (GPX3), mRNA.
Product glutathione peroxidase 3 precursor
Comment

Summary: This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq, Jul 2008].

RefSeq NP_002075.2
CDS 218..898
Misc Feature(1)197..199
Misc Feature(2)332..850
Misc Feature(3)order(434..436,536..538,758..760)
Misc Feature(4)434..436
Misc Feature(5)order(533..535,542..544,548..550,557..559,566..568,
Exon (1)1..304
Gene:GPX3
Gene Synonym:GPx-P; GSHPx-3; GSHPx-P
Exon (2)305..458
Gene:GPX3
Gene Synonym:GPx-P; GSHPx-3; GSHPx-P
Exon (3)459..576
Gene:GPX3
Gene Synonym:GPx-P; GSHPx-3; GSHPx-P
Exon (4)577..676
Gene:GPX3
Gene Synonym:GPx-P; GSHPx-3; GSHPx-P
Exon (5)677..1761
Gene:GPX3
Gene Synonym:GPx-P; GSHPx-3; GSHPx-P
Translation MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYA GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIR WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
84+dbSNP:
84+c, gdbSNP:8177411
89+c, tdbSNP:8177412
256+c, gdbSNP:8177413
261+c, tdbSNP:377617159
265+c, tdbSNP:370954217
273+a, tdbSNP:375877920
276+c, tdbSNP:377710604
316+dbSNP:
316+c, tdbSNP:367725712
341+a, gdbSNP:200128541
370+c, gdbSNP:371966819
420+a, gdbSNP:373981887
421+c, tdbSNP:142849792
444+c, tdbSNP:371856135
445+a, gdbSNP:200228989
456+c, tdbSNP:368521899
490+dbSNP:
490+a, gdbSNP:373194048
500+a, gdbSNP:200221775
541+a, gdbSNP:200416261
551+a, cdbSNP:369298257
589+dbSNP:
589+a, cdbSNP:371422003
599+c, tdbSNP:8177445
617+c, tdbSNP:373449699
621+g, tdbSNP:201249129
631+a, gdbSNP:370194625
647+a, tdbSNP:11544082
665+a, gdbSNP:373809425
683+dbSNP:
683+c, tdbSNP:200470998
720+a, gdbSNP:374193246
734+c, tdbSNP:184186742
807+a, gdbSNP:372652345
819+a, gdbSNP:370891492
826+a, gdbSNP:375837316
832+a, cdbSNP:368970475
835+c, tdbSNP:371559625
884+a, gdbSNP:376670831
891+c, gdbSNP:369084683
900+g, tdbSNP:200511585
901+a, gdbSNP:200721773
908+a, gdbSNP:373873682
965+c, tdbSNP:1803677
971+c, tdbSNP:188838205
990+c, tdbSNP:11548
complement(995)-t, cdbSNP:150488167
1036+g, tdbSNP:2230303
1059+a, gdbSNP:7722386
1142+a, gdbSNP:8177448
1146+c, tdbSNP:8177449
1147+a, gdbSNP:2070593
1153+a, gdbSNP:8177450
1154+c, tdbSNP:8177451
1279+a, gdbSNP:192433815
1302+a, gdbSNP:79250800
1315..1318+, aactdbSNP:375078202
1387+a, tdbSNP:373584330
1407+a, c, tdbSNP:1064506
1422+a, cdbSNP:143049264
1506+a, gdbSNP:8177452
1522+c, tdbSNP:4661
1536+c, gdbSNP:17111673
1555+c, tdbSNP:138719981
1611+c, tdbSNP:1059316
1640+a, cdbSNP:8177453
1728+a, gdbSNP:187389496
Gene SymbolGPX3
Gene SynonymGPx-P; GSHPx-3; GSHPx-P
Chromosome5
Locus Map5q23
Title Altered expression of inflammation-associated genes in oviductal cells following follicular fluid exposure: implications for ovarian carcinogenesis .
Author Lau A, Kollara A, St John E, Tone AA, Virtanen C, Greenblatt EM, King WA and Brown TJ.
Journal Exp. Biol. Med. (Maywood) 239 (1), 24-32 (2014)
Title Functional diversity of the glutathione peroxidase gene family among human populations: implications for genetic predisposition to disease and drug response .
Author Polimanti R, Fuciarelli M, Destro-Bisol G and Battaggia C.
Journal Pharmacogenomics 14 (9), 1037-1045 (2013)
Title ITIH4 and Gpx3 are potential biomarkers for amyotrophic lateral sclerosis .
Author Tanaka H, Shimazawa M, Takata M, Kaneko H, Tsuruma K, Ikeda T, Warita H, Aoki M, Yamada M, Takahashi H, Hozumi I, Minatsu H, Inuzuka T and Hara H.
Journal J. Neurol. 260 (7), 1782-1797 (2013)
Title Glutathione peroxidase 3, a new retinoid target gene, is crucial for human skeletal muscle precursor cell survival .
Author El Haddad M, Jean E, Turki A, Hugon G, Vernus B, Bonnieu A, Passerieux E, Hamade A, Mercier J, Laoudj-Chenivesse D and Carnac G.
Journal J. Cell. Sci. 125 (PT 24), 6147-6156 (2012)
Title Silencing of glutathione peroxidase 3 through DNA hypermethylation is associated with lymph node metastasis in gastric carcinomas .
Author Peng DF, Hu TL, Schneider BG, Chen Z, Xu ZK and El-Rifai W.
Journal PLoS ONE 7 (10), E46214 (2012)
Title Expression of plasma glutathione peroxidase in human liver in addition to kidney, heart, lung, and breast in humans and rodents .
Author Chu FF, Esworthy RS, Doroshow JH, Doan K and Liu XF.
Journal Blood 79 (12), 3233-3238 (1992)
Title Characterization and partial amino acid sequence of human plasma glutathione peroxidase .
Author Esworthy RS, Chu FF, Paxton RJ, Akman S and Doroshow JH.
Journal Arch. Biochem. Biophys. 286 (2), 330-336 (1991)
Title Primary structure of human plasma glutathione peroxidase deduced from cDNA sequences .
Author Takahashi K, Akasaka M, Yamamoto Y, Kobayashi C, Mizoguchi J and Koyama J.
Journal J. Biochem. 108 (2), 145-148 (1990)
Title Antihuman plasma glutathione peroxidase antibodies: immunologic investigations to determine plasma glutathione peroxidase protein and selenium content in plasma .
Author Avissar N, Whitin JC, Allen PZ, Palmer IS and Cohen HJ.
Journal Blood 73 (1), 318-323 (1989)
Title Purification and characterization of human plasma glutathione peroxidase: a selenoglycoprotein distinct from the known cellular enzyme .
Author Takahashi,K., Avissar,N., Whitin,J. and Cohen,H.
Journal Arch. Biochem. Biophys. 256 (2), 677-686 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.