• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-X-C motif) ligand 3 (CXCL3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu03827 Homo sapiens chemokine (C-X-C motif) ligand 3 (CXCL3), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu03827C Homo sapiens chemokine (C-X-C motif) ligand 3 (CXCL3), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002090.2, 54144649
Length 324 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-X-C motif) ligand 3 (CXCL3), mRNA.
Product C-X-C motif chemokine 3 precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BM828712.1, BC065743.1 and AW079760.1. On Oct 15, 2004 this sequence version replaced gi:4504156.

RefSeq NP_002081.2
CDS 163..486
Misc Feature(1)280..468
Misc Feature(2)order(280..288,304..306,316..333,358..366,394..399,
Misc Feature(3)280..288
Misc Feature(4)order(283..285,292..294,331..336,343..351,379..390,
Misc Feature(5)order(283..285,292..294,343..345,349..351,379..381,
Misc Feature(6)order(286..291,295..297)
Misc Feature(7)order(292..312,316..333)
Misc Feature(8)order(298..303,307..309,316..318,328..330,385..387,
Misc Feature(9)order(319..321,325..327,427..429,436..438,442..453,
Misc Feature(10)order(325..327,334..336,391..393,397..399,406..411)
Misc Feature(11)order(331..336,346..348,382..384,388..390,418..420,
Misc Feature(12)358..366
Misc Feature(13)358..366
Misc Feature(14)397..405
Exon (1)1..262
Gene:CXCL3
Gene Synonym:CINC-2b; GRO3; GROg; MIP-2b; MIP2B; SCYB3
Exon (2)263..386
Gene:CXCL3
Gene Synonym:CINC-2b; GRO3; GROg; MIP-2b; MIP2B; SCYB3
Exon (3)387..470
Gene:CXCL3
Gene Synonym:CINC-2b; GRO3; GROg; MIP-2b; MIP2B; SCYB3
Exon (4)471..1159
Gene:CXCL3
Gene Synonym:CINC-2b; GRO3; GROg; MIP-2b; MIP2B; SCYB3
Translation MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-dbSNP:
complement(31)-t, gdbSNP:201152033
complement(79)-t, cdbSNP:200492242
complement(87)-t, gdbSNP:199782009
complement(91)-g, adbSNP:201480179
complement(113)-t, cdbSNP:200362235
complement(129)-g, adbSNP:201936501
complement(170)-g, adbSNP:352043
complement(172)-g, cdbSNP:200464221
complement(195)-t, gdbSNP:182216932
complement(211)-t, gdbSNP:189466801
complement(219)-c, adbSNP:199829667
complement(271)-dbSNP:
complement(271)-t, cdbSNP:200553995
complement(297)-g, adbSNP:199499790
complement(306)-t, gdbSNP:139655860
complement(315)-t, gdbSNP:200899993
complement(335)-t, cdbSNP:372884271
complement(344)-t, cdbSNP:369343727
complement(345)-g, adbSNP:376832730
complement(352)-t, adbSNP:200035503
complement(353)-g, adbSNP:200604462
complement(357)-g, adbSNP:199744046
complement(359)-t, cdbSNP:180805941
complement(370)-g, cdbSNP:200228799
complement(379)-t, cdbSNP:202147554
complement(412)-dbSNP:
complement(412)-c, adbSNP:149422615
complement(428)-g, adbSNP:201940372
complement(453)-t, gdbSNP:201123855
complement(474)-dbSNP:
complement(474)-c, adbSNP:201340451
complement(481)-t, cdbSNP:199913594
complement(490)-t, cdbSNP:368197936
complement(499)-t, gdbSNP:201571220
complement(504)-g, cdbSNP:200741239
complement(506)-c, adbSNP:200096542
complement(513)-t, gdbSNP:371129154
complement(514)-t, cdbSNP:201732413
complement(521)-g, adbSNP:185155671
complement(522)-t, cdbSNP:199810402
complement(524)-g, adbSNP:374315451
complement(529)-g, adbSNP:201781698
complement(534)-t, cdbSNP:200611108
complement(540)-t, cdbSNP:199509809
complement(551)-g, adbSNP:201483390
complement(561)-t, cdbSNP:200565678
complement(571)-t, gdbSNP:199753671
complement(597)-t, cdbSNP:151083701
complement(608)-g, cdbSNP:201421057
complement(618)-g, adbSNP:200262907
complement(632)-g, adbSNP:201879346
complement(633)-t, cdbSNP:200886112
complement(639)-t, adbSNP:200253429
complement(689)-t, cdbSNP:201791349
complement(690)-g, adbSNP:201127219
complement(713)-t, cdbSNP:200151056
complement(715)-g, cdbSNP:202015979
complement(748)-t, gdbSNP:201055105
complement(749)-t, cdbSNP:199876137
complement(759)-t, cdbSNP:201862278
complement(791)-g, adbSNP:112785228
complement(800)-g, cdbSNP:192662858
complement(801)-t, cdbSNP:13150258
complement(868)-g, adbSNP:199743689
complement(873)-t, adbSNP:201735236
complement(891)-t, cdbSNP:200716830
complement(898)-t, cdbSNP:199778175
complement(925)-t, adbSNP:201623624
complement(927)-t, gdbSNP:200320368
complement(937)-t, adbSNP:199517714
938+a, tdbSNP:1051754
complement(946)-t, cdbSNP:113503574
complement(956)-c, adbSNP:200396970
complement(968)-t, cdbSNP:201824210
complement(983)-g, adbSNP:201068516
complement(1000)-c, adbSNP:200245948
complement(1002)-g, adbSNP:202150150
complement(1008)-g, adbSNP:201223860
complement(1019)-g, adbSNP:199936057
complement(1025)-t, adbSNP:201745827
complement(1049)-g, adbSNP:200931739
complement(1053)-t, cdbSNP:200113321
complement(1073)-g, adbSNP:202023964
complement(1074)-t, cdbSNP:200666836
complement(1077)-g, adbSNP:199844400
complement(1078)-g, adbSNP:370395758
complement(1085)-g, adbSNP:182282902
complement(1097)-c, adbSNP:201853929
complement(1116)-g, adbSNP:200713242
complement(1117)-t, cdbSNP:199783720
complement(1118)-c, adbSNP:201123122
complement(1124)-t, gdbSNP:200490707
complement(1126)-t, cdbSNP:199742726
complement(1137)-t, adbSNP:201654645
complement(1138)-t, cdbSNP:200326371
complement(1140)-t, cdbSNP:202111634
complement(1142)-t, cdbSNP:201368914
complement(1144)-c, adbSNP:200470736
complement(1150)-g, adbSNP:202123605
complement(1151..1152)-, tdbSNP:374617274
Gene SymbolCXCL3
Gene SynonymCINC-2b; GRO3; GROg; MIP-2b; MIP2B; SCYB3
Chromosome4
Locus Map4q21
Title Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration .
Author Al-Alwan LA, Chang Y, Mogas A, Halayko AJ, Baglole CJ, Martin JG, Rousseau S, Eidelman DH and Hamid Q.
Journal J. Immunol. 191 (5), 2731-2741 (2013)
Title Mesenchymal stem cells tune the development of monocyte-derived dendritic cells toward a myeloid-derived suppressive phenotype through growth-regulated oncogene chemokines .
Author Chen HW, Chen HY, Wang LT, Wang FH, Fang LW, Lai HY, Chen HH, Lu J, Hung MS, Cheng Y, Chen MY, Liu SJ, Chong P, Lee OK and Hsu SC.
Journal J. Immunol. 190 (10), 5065-5077 (2013)
Title Upregulation of chemokines and their receptors in Duchenne muscular dystrophy: potential for attenuation of myofiber necrosis .
Author De Paepe B, Creus KK, Martin JJ and De Bleecker JL.
Journal Muscle Nerve 46 (6), 917-925 (2012)
Title Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease .
Author Jostins L, Ripke S, Weersma RK, Duerr RH, McGovern DP, Hui KY, Lee JC, Schumm LP, Sharma Y, Anderson CA, Essers J, Mitrovic M, Ning K, Cleynen I, Theatre E, Spain SL, Raychaudhuri S, Goyette P, Wei Z, Abraham C, Achkar JP, Ahmad T, Amininejad L, Ananthakrishnan AN, Andersen V, Andrews JM, Baidoo L, Balschun T, Bampton PA, Bitton A, Boucher G, Brand S, Buning C, Cohain A, Cichon S, D'Amato M, De Jong D, Devaney KL, Dubinsky M, Edwards C, Ellinghaus D, Ferguson LR, Franchimont D, Fransen K, Gearry R, Georges M, Gieger C, Glas J, Haritunians T, Hart A, Hawkey C, Hedl M, Hu X, Karlsen TH, Kupcinskas L, Kugathasan S, Latiano A, Laukens D, Lawrance IC, Lees CW, Louis E, Mahy G, Mansfield J, Morgan AR, Mowat C, Newman W, Palmieri O, Ponsioen CY, Potocnik U, Prescott NJ, Regueiro M, Rotter JI, Russell RK, Sanderson JD, Sans M, Satsangi J, Schreiber S, Simms LA, Sventoraityte J, Targan SR, Taylor KD, Tremelling M, Verspaget HW, De Vos M, Wijmenga C, Wilson DC, Winkelmann J, Xavier RJ, Zeissig S, Zhang B, Zhang CK, Zhao H, Silverberg MS, Annese V, Hakonarson H, Brant SR, Radford-Smith G, Mathew CG, Rioux JD, Schadt EE, Daly MJ, Franke A, Parkes M, Vermeire S, Barrett JC and Cho JH.
Journal Nature 491 (7422), 119-124 (2012)
Title Mesenchymal stem cells regulate the proliferation of T cells via the growth-related oncogene/CXC chemokine receptor, CXCR2 .
Author Lee YS, Won KJ, Park SW, Lee HW, Kim B, Kim JH and Kim DK.
Journal Cell. Immunol. 279 (1), 1-11 (2012)
Title Isolation of the CXC chemokines ENA-78, GRO alpha and GRO gamma from tumor cells and leukocytes reveals NH2-terminal heterogeneity. Functional comparison of different natural isoforms .
Author Wuyts A, Govaerts C, Struyf S, Lenaerts JP, Put W, Conings R, Proost P and Van Damme J.
Journal Eur. J. Biochem. 260 (2), 421-429 (1999)
Title An NF-kappa B-like transcription factor mediates IL-1/TNF-alpha induction of gro in human fibroblasts .
Author Anisowicz A, Messineo M, Lee SW and Sager R.
Journal J. Immunol. 147 (2), 520-527 (1991)
Title Nucleotide sequence of the human melanoma growth stimulatory activity (MGSA) gene .
Author Baker NE, Kucera G and Richmond A.
Journal Nucleic Acids Res. 18 (21), 6453 (1990)
Title Identification of three related human GRO genes encoding cytokine functions .
Author Haskill S, Peace A, Morris J, Sporn SA, Anisowicz A, Lee SW, Smith T, Martin G, Ralph P and Sager R.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (19), 7732-7736 (1990)
Title Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues .
Author Tekamp-Olson P, Gallegos C, Bauer D, McClain J, Sherry B, Fabre M, van Deventer S and Cerami A.
Journal J. Exp. Med. 172 (3), 911-919 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.