• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-X-C motif) ligand 3 (CXCL3), mRNA.


RefSeq Accession Definition Services Price Order
NM_002090 Homo sapiens chemokine (C-X-C motif) ligand 3 (CXCL3), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002090.2, 54144649
Length 1166 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-X-C motif) ligand 3 (CXCL3), mRNA.
Product C-X-C motif chemokine 3 precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BM828712.1, BC065743.1 and AW079760.1. On Oct 15, 2004 this sequence version replaced gi:4504156.

RefSeq NP_002081.2
CDS 163..486
Misc Feature(1)280..468
Misc Feature(2)order(280..288,304..306,316..333,358..366,394..399,
Misc Feature(3)280..288
Misc Feature(4)order(283..285,292..294,331..336,343..351,379..390,
Misc Feature(5)order(283..285,292..294,343..345,349..351,379..381,
Misc Feature(6)order(286..291,295..297)
Misc Feature(7)order(292..312,316..333)
Misc Feature(8)order(298..303,307..309,316..318,328..330,385..387,
Misc Feature(9)order(319..321,325..327,427..429,436..438,442..453,
Misc Feature(10)order(325..327,334..336,391..393,397..399,406..411)
Misc Feature(11)order(331..336,346..348,382..384,388..390,418..420,
Misc Feature(12)358..366
Misc Feature(13)358..366
Misc Feature(14)397..405
Exon (1)1..262
Gene:CXCL3
Gene Synonym:CINC-2b; GRO3; GROg; MIP-2b; MIP2B; SCYB3
Exon (2)263..386
Gene:CXCL3
Gene Synonym:CINC-2b; GRO3; GROg; MIP-2b; MIP2B; SCYB3
Exon (3)387..470
Gene:CXCL3
Gene Synonym:CINC-2b; GRO3; GROg; MIP-2b; MIP2B; SCYB3
Exon (4)471..1159
Gene:CXCL3
Gene Synonym:CINC-2b; GRO3; GROg; MIP-2b; MIP2B; SCYB3
Translation MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-dbSNP:
complement(31)-t, gdbSNP:201152033
complement(79)-t, cdbSNP:200492242
complement(87)-t, gdbSNP:199782009
complement(91)-g, adbSNP:201480179
complement(113)-t, cdbSNP:200362235
complement(129)-g, adbSNP:201936501
complement(170)-g, adbSNP:352043
complement(172)-g, cdbSNP:200464221
complement(195)-t, gdbSNP:182216932
complement(211)-t, gdbSNP:189466801
complement(219)-c, adbSNP:199829667
complement(271)-dbSNP:
complement(271)-t, cdbSNP:200553995
complement(297)-g, adbSNP:199499790
complement(306)-t, gdbSNP:139655860
complement(315)-t, gdbSNP:200899993
complement(352)-t, adbSNP:200035503
complement(353)-g, adbSNP:200604462
complement(354)-t, gdbSNP:146368558
complement(357)-g, adbSNP:199744046
complement(359)-t, cdbSNP:180805941
complement(370)-g, cdbSNP:200228799
complement(379)-t, cdbSNP:202147554
complement(412)-dbSNP:
complement(412)-c, adbSNP:149422615
complement(428)-g, adbSNP:201940372
complement(453)-t, gdbSNP:201123855
complement(474)-dbSNP:
complement(474)-c, adbSNP:201340451
complement(481)-t, cdbSNP:199913594
complement(499)-t, gdbSNP:201571220
complement(504)-g, cdbSNP:200741239
complement(506)-c, adbSNP:200096542
complement(514)-t, cdbSNP:201732413
complement(521)-g, adbSNP:185155671
complement(522)-t, cdbSNP:199810402
complement(529)-g, adbSNP:201781698
complement(534)-t, cdbSNP:200611108
complement(540)-t, cdbSNP:199509809
complement(551)-g, adbSNP:201483390
complement(561)-t, cdbSNP:200565678
complement(571)-t, gdbSNP:199753671
complement(597)-t, cdbSNP:151083701
complement(608)-g, cdbSNP:201421057
complement(618)-g, adbSNP:200262907
complement(632)-g, adbSNP:201879346
complement(633)-t, cdbSNP:200886112
complement(639)-t, adbSNP:200253429
complement(689)-t, cdbSNP:201791349
complement(690)-g, adbSNP:201127219
complement(713)-t, cdbSNP:200151056
complement(715)-g, cdbSNP:202015979
complement(748)-t, gdbSNP:201055105
complement(749)-t, cdbSNP:199876137
complement(759)-t, cdbSNP:201862278
complement(791)-g, adbSNP:112785228
complement(800)-g, cdbSNP:192662858
complement(801)-t, cdbSNP:13150258
complement(868)-g, adbSNP:199743689
complement(873)-t, adbSNP:201735236
complement(891)-t, cdbSNP:200716830
complement(898)-t, cdbSNP:199778175
complement(925)-t, adbSNP:201623624
complement(927)-t, gdbSNP:200320368
complement(937)-t, adbSNP:199517714
complement(937)-, adbSNP:71788353
complement(938)-t, adbSNP:1051754
complement(946)-t, cdbSNP:113503574
complement(956)-c, adbSNP:200396970
complement(968)-t, cdbSNP:201824210
complement(983)-g, adbSNP:201068516
complement(1000)-c, adbSNP:200245948
complement(1002)-g, adbSNP:202150150
complement(1008)-g, adbSNP:201223860
complement(1019)-g, adbSNP:199936057
complement(1025)-t, adbSNP:201745827
complement(1049)-g, adbSNP:200931739
complement(1053)-t, cdbSNP:200113321
complement(1073)-g, adbSNP:202023964
complement(1074)-t, cdbSNP:200666836
complement(1077)-g, adbSNP:199844400
complement(1085)-g, adbSNP:182282902
complement(1097)-c, adbSNP:201853929
complement(1116)-g, adbSNP:200713242
complement(1117)-t, cdbSNP:199783720
complement(1118)-c, adbSNP:201123122
complement(1124)-t, gdbSNP:200490707
complement(1126)-t, cdbSNP:199742726
complement(1137)-t, adbSNP:201654645
complement(1138)-t, cdbSNP:200326371
complement(1140)-t, cdbSNP:202111634
complement(1142)-t, cdbSNP:201368914
complement(1144)-c, adbSNP:200470736
complement(1150)-g, adbSNP:202123605
Gene SymbolCXCL3
Gene SynonymCINC-2b; GRO3; GROg; MIP-2b; MIP2B; SCYB3
Chromosome4
Locus Map4q21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002090 Homo sapiens chemokine (C-X-C motif) ligand 3 (CXCL3), mRNA. Full Length $338.14
ORF Sequence $159.00
Title Upregulation of chemokines and their receptors in Duchenne muscular dystrophy: potential for attenuation of myofiber necrosis .
Author De Paepe,B., Creus,K.K., Martin,J.J. and De Bleecker,J.L.
Journal Muscle Nerve 46 (6), 917-925 (2012)
Title Mesenchymal stem cells regulate the proliferation of T cells via the growth-related oncogene/CXC chemokine receptor, CXCR2 .
Author Lee,Y.S., Won,K.J., Park,S.W., Lee,H.W., Kim,B., Kim,J.H. and Kim,D.K.
Journal Cell. Immunol. 279 (1), 1-11 (2012)
Title Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility 'hot-spot' .
Author Johnatty,S.E., Beesley,J., Chen,X., Macgregor,S., Duffy,D.L., Spurdle,A.B., deFazio,A., Gava,N., Webb,P.M., Rossing,M.A., Doherty,J.A., Goodman,M.T., Lurie,G., Thompson,P.J., Wilkens,L.R., Ness,R.B., Moysich,K.B., Chang-Claude,J., Wang-Gohrke,S., Cramer,D.W., Terry,K.L., Hankinson,S.E., Tworoger,S.S., Garcia-Closas,M., Yang,H., Lissowska,J., Chanock,S.J., Pharoah,P.D., Song,H., Whitemore,A.S., Pearce,C.L., Stram,D.O., Wu,A.H., Pike,M.C., Gayther,S.A., Ramus,S.J., Menon,U., Gentry-Maharaj,A., Anton-Culver,H., Ziogas,A., Hogdall,E., Kjaer,S.K., Hogdall,C., Berchuck,A., Schildkraut,J.M., Iversen,E.S., Moorman,P.G., Phelan,C.M., Sellers,T.A., Cunningham,J.M., Vierkant,R.A., Rider,D.N., Goode,E.L., Haviv,I. and Chenevix-Trench,G.
Journal PLoS Genet. 6 (7), E1001016 (2010)
Title Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls .
Author Schuurhof,A., Bont,L., Siezen,C.L., Hodemaekers,H., van Houwelingen,H.C., Kimman,T.G., Hoebee,B., Kimpen,J.L. and Janssen,R.
Journal Pediatr. Pulmonol. 45 (6), 608-613 (2010)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Isolation of the CXC chemokines ENA-78, GRO alpha and GRO gamma from tumor cells and leukocytes reveals NH2-terminal heterogeneity. Functional comparison of different natural isoforms .
Author Wuyts,A., Govaerts,C., Struyf,S., Lenaerts,J.P., Put,W., Conings,R., Proost,P. and Van Damme,J.
Journal Eur. J. Biochem. 260 (2), 421-429 (1999)
Title An NF-kappa B-like transcription factor mediates IL-1/TNF-alpha induction of gro in human fibroblasts .
Author Anisowicz,A., Messineo,M., Lee,S.W. and Sager,R.
Journal J. Immunol. 147 (2), 520-527 (1991)
Title Nucleotide sequence of the human melanoma growth stimulatory activity (MGSA) gene .
Author Baker,N.E., Kucera,G. and Richmond,A.
Journal Nucleic Acids Res. 18 (21), 6453 (1990)
Title Identification of three related human GRO genes encoding cytokine functions .
Author Haskill,S., Peace,A., Morris,J., Sporn,S.A., Anisowicz,A., Lee,S.W., Smith,T., Martin,G., Ralph,P. and Sager,R.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (19), 7732-7736 (1990)
Title Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues .
Author Tekamp-Olson,P., Gallegos,C., Bauer,D., McClain,J., Sherry,B., Fabre,M., van Deventer,S. and Cerami,A.
Journal J. Exp. Med. 172 (3), 911-919 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878