Homo sapiens chemokine (C-X-C motif) ligand 3 (CXCL3), mRNA.
| RefSeq Version | NM_002090.2, 54144649 |
| Length | 1166 bp |
| Structure | linear |
| Update Date | 13-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens chemokine (C-X-C motif) ligand 3 (CXCL3), mRNA. |
| Product | C-X-C motif chemokine 3 |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BM828712.1, BC065743.1 and AW079760.1. On Oct 15, 2004 this sequence version replaced gi:4504156. |
| RefSeq | NP_002081.2 |
| CDS | 163..486 | Exon (1) | 1..262 | Exon (2) | 1..262 | Exon (3) | 263..386 | Exon (4) | 387..470 | Exon (5) | 471..1159 |
| Translation | MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV
NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 170 | + | a, g | dbSNP:352043 |
| complement(791) | - | g, a | dbSNP:112785228 |
| complement(801) | - | t, c | dbSNP:13150258 |
| complement(937) | - | , a | dbSNP:71788353 |
| 938 | + | a, t | dbSNP:1051754 |
| complement(946) | - | t, c | dbSNP:113503574 |
| Gene Symbol | CXCL3 |
| Gene Synonym | CINC-2b; GRO3; GROg; MIP-2b; MIP2B; SCYB3 |
| Chromosome | 4 |
| Locus Map | 4q21 |
| All Transcripts | NM_002090 |
| Title | Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility 'hot-spot' . |
| Author | Johnatty,S.E., Beesley,J., Chen,X., Macgregor,S., Duffy,D.L., Spurdle,A.B., deFazio,A., Gava,N., Webb,P.M., Rossing,M.A., Doherty,J.A., Goodman,M.T., Lurie,G., Thompson,P.J., Wilkens,L.R., Ness,R.B., Moysich,K.B., Chang-Claude,J., Wang-Gohrke,S., Cramer,D.W., Terry,K.L., Hankinson,S.E., Tworoger,S.S., Garcia-Closas,M., Yang,H., Lissowska,J., Chanock,S.J., Pharoah,P.D., Song,H., Whitemore,A.S., Pearce,C.L., Stram,D.O., Wu,A.H., Pike,M.C., Gayther,S.A., Ramus,S.J., Menon,U., Gentry-Maharaj,A., Anton-Culver,H., Ziogas,A., Hogdall,E., Kjaer,S.K., Hogdall,C., Berchuck,A., Schildkraut,J.M., Iversen,E.S., Moorman,P.G., Phelan,C.M., Sellers,T.A., Cunningham,J.M., Vierkant,R.A., Rider,D.N., Goode,E.L., Haviv,I. and Chenevix-Trench,G. |
| Journal | PLoS Genet. 6 (7), E1001016 (2010) |
| Title | Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls . |
| Author | Schuurhof,A., Bont,L., Siezen,C.L., Hodemaekers,H., van Houwelingen,H.C., Kimman,T.G., Hoebee,B., Kimpen,J.L. and Janssen,R. |
| Journal | Pediatr. Pulmonol. 45 (6), 608-613 (2010) |
| Title | Differential expression of the chemokines GRO-2, GRO-3, and interleukin-8 in colon cancer and their impact on metastatic disease and survival . |
| Author | Doll,D., Keller,L., Maak,M., Boulesteix,A.L., Siewert,J.R., Holzmann,B. and Janssen,K.P. |
| Journal | Int J Colorectal Dis 25 (5), 573-581 (2010) |
| Title | New genetic associations detected in a host response study to hepatitis B vaccine . |
| Author | Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M. |
| Journal | Genes Immun. 11 (3), 232-238 (2010) |
| Title | Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment . |
| Author | Segat,L., Brandao,L.A., Guimaraes,R.L., Pontillo,A., Athanasakis,E., de Oliveira,R.M., Arraes,L.C., de Lima Filho,J.L. and Crovella,S. |
| Journal | Vaccine 28 (10), 2201-2206 (2010) |
| Title | Isolation of the CXC chemokines ENA-78, GRO alpha and GRO gamma from tumor cells and leukocytes reveals NH2-terminal heterogeneity. Functional comparison of different natural isoforms . |
| Author | Wuyts,A., Govaerts,C., Struyf,S., Lenaerts,J.P., Put,W., Conings,R., Proost,P. and Van Damme,J. |
| Journal | Eur. J. Biochem. 260 (2), 421-429 (1999) |
| Title | An NF-kappa B-like transcription factor mediates IL-1/TNF-alpha induction of gro in human fibroblasts . |
| Author | Anisowicz,A., Messineo,M., Lee,S.W. and Sager,R. |
| Journal | J. Immunol. 147 (2), 520-527 (1991) |
| Title | Nucleotide sequence of the human melanoma growth stimulatory activity (MGSA) gene . |
| Author | Baker,N.E., Kucera,G. and Richmond,A. |
| Journal | Nucleic Acids Res. 18 (21), 6453 (1990) |
| Title | Identification of three related human GRO genes encoding cytokine functions . |
| Author | Haskill,S., Peace,A., Morris,J., Sporn,S.A., Anisowicz,A., Lee,S.W., Smith,T., Martin,G., Ralph,P. and Sager,R. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 87 (19), 7732-7736 (1990) |
| Title | Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues . |
| Author | Tekamp-Olson,P., Gallegos,C., Bauer,D., McClain,J., Sherry,B., Fabre,M., van Deventer,S. and Cerami,A. |
| Journal | J. Exp. Med. 172 (3), 911-919 (1990) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |