• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glycogen synthase kinase 3 beta (GSK3B), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002093 Homo sapiens glycogen synthase kinase 3 beta (GSK3B), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_002093.3, 225903415
Length 7134 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens glycogen synthase kinase 3 beta (GSK3B), transcript variant 1, mRNA.
Product glycogen synthase kinase-3 beta isoform 1
Comment

Summary: The protein encoded by this gene is a serine-threonine kinase, belonging to the glycogen synthase kinase subfamily. It is involved in energy metabolism, neuronal cell development, and body pattern formation. Polymorphisms in this gene have been implicated in modifying risk of Parkinson disease, and studies in mice show that overexpression of this gene may be relevant to the pathogenesis of Alzheimer disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009].


Transcript Variant: This variant (1) encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002084.2
CDS 984..2285
Misc Feature(1)963..965
Misc Feature(2)1008..1010
Misc Feature(3)1008..1010
Misc Feature(4)1008..1010
Misc Feature(5)1008..1010
Misc Feature(6)1044..1046
Misc Feature(7)1149..2063
Misc Feature(8)1149..2042
Misc Feature(9)order(1167..1181,1191..1193,1230..1232,1236..1238,
Misc Feature(10)order(1167..1181,1191..1193,1230..1232,1236..1238,
Misc Feature(11)order(1179..1181,1395..1397,1401..1403,1524..1526,
Misc Feature(12)order(1578..1598,1635..1646)
Misc Feature(13)1626..1628
Misc Feature(14)1629..1631
Misc Feature(15)2187..2189
Misc Feature(16)2190..2192
Exon (1)1..1071
Gene:GSK3B
Gene Synonym:GSK3B
Exon (2)1072..1265
Gene:GSK3B
Gene Synonym:GSK3B
Exon (3)1266..1349
Gene:GSK3B
Gene Synonym:GSK3B
Exon (4)1350..1460
Gene:GSK3B
Gene Synonym:GSK3B
Exon (5)1461..1591
Gene:GSK3B
Gene Synonym:GSK3B
Exon (6)1592..1698
Gene:GSK3B
Gene Synonym:GSK3B
Exon (7)1699..1796
Gene:GSK3B
Gene Synonym:GSK3B
Exon (8)1797..1892
Gene:GSK3B
Gene Synonym:GSK3B
Exon (9)1893..1931
Gene:GSK3B
Gene Synonym:GSK3B
Exon (10)1932..2118
Gene:GSK3B
Gene Synonym:GSK3B
Exon (11)2119..2217
Gene:GSK3B
Gene Synonym:GSK3B
Exon (12)2218..7120
Gene:GSK3B
Gene Synonym:GSK3B
Translation MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQ TNNAASASASNST
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(32..33)-dbSNP:
complement(32..33)-, ggcdbSNP:371091405
complement(51)-t, cdbSNP:201583278
complement(58)-t, cdbSNP:200264730
complement(104)-g, adbSNP:199531793
complement(113)-t, gdbSNP:201519023
complement(219)-g, adbSNP:200441865
complement(257)-t, cdbSNP:202219676
complement(266)-t, cdbSNP:201071686
complement(269)-g, adbSNP:200352699
complement(280)-t, cdbSNP:202110584
complement(286)-g, adbSNP:201228928
complement(289)-g, adbSNP:199978432
complement(308)-c, adbSNP:201334863
complement(324)-t, cdbSNP:200769741
complement(361)-t, cdbSNP:200168029
complement(374)-g, adbSNP:2276708
complement(375)-g, adbSNP:200660067
complement(377..378)-, tgdbSNP:371551295
complement(402)-g, adbSNP:199860316
complement(408)-g, adbSNP:201865880
complement(409)-g, adbSNP:113334667
complement(426)-g, adbSNP:200723700
complement(428)-g, adbSNP:199722780
complement(432)-c, adbSNP:201364716
complement(443)-t, cdbSNP:41271403
complement(450)-t, cdbSNP:199796429
complement(454)-g, adbSNP:201577714
complement(456)-, adbSNP:58853520
complement(468)-t, cdbSNP:200332951
complement(485)-g, adbSNP:202114779
complement(487)-g, adbSNP:375143060
complement(502)-t, gdbSNP:201249453
complement(508)-g, adbSNP:112784235
complement(529)-g, adbSNP:201837734
complement(539)-c, adbSNP:200882963
complement(581)-t, gdbSNP:199883898
complement(586)-t, cdbSNP:202121664
complement(601)-g, adbSNP:201252906
complement(605)-c, adbSNP:199957194
complement(638)-t, cdbSNP:201951987
complement(654)-g, adbSNP:200541026
688+a, gdbSNP:144469946
complement(694)-g, adbSNP:200126942
complement(701)-g, adbSNP:201847348
706+c, gdbSNP:72546688
complement(708)-g, adbSNP:199507027
complement(728)-t, cdbSNP:201553320
complement(730)-c, adbSNP:200884356
complement(734)-t, adbSNP:199674591
complement(759)-t, cdbSNP:201134658
complement(774)-t, g, cdbSNP:200248846
complement(801)-g, adbSNP:144673916
complement(804)-g, adbSNP:201158378
complement(805)-c, adbSNP:371021532
complement(806)-t, gdbSNP:200349278
complement(864)-c, adbSNP:202142326
complement(865)-c, adbSNP:200974811
901+a, tdbSNP:72546689
complement(904)-c, adbSNP:149781877
complement(931)-t, gdbSNP:200198483
complement(939)-t, cdbSNP:202129041
complement(967)-g, adbSNP:376366660
complement(968)-g, adbSNP:201029919
977+a, gdbSNP:72546690
complement(989)-t, cdbSNP:199845730
complement(1026)-t, cdbSNP:373508918
complement(1036)-t, cdbSNP:201865088
complement(1045)-g, adbSNP:201086798
complement(1062)-t, cdbSNP:199935462
complement(1082)-dbSNP:
complement(1082)-g, adbSNP:137972044
complement(1123)-c, adbSNP:200600198
complement(1126)-g, adbSNP:199688358
complement(1158)-t, cdbSNP:201555172
1178+a, tdbSNP:34002644
complement(1191)-t, cdbSNP:184532476
complement(1193)-t, cdbSNP:200643730
complement(1216)-g, adbSNP:202134968
complement(1224)-g, adbSNP:199513361
complement(1232)-g, adbSNP:141817453
complement(1244)-t, cdbSNP:140229288
complement(1283)-dbSNP:
complement(1283)-g, adbSNP:201819139
complement(1313)-g, adbSNP:201146011
complement(1402)-dbSNP:
complement(1402)-t, cdbSNP:374053953
complement(1410)-c, adbSNP:200380044
complement(1415)-t, cdbSNP:146668166
1438..1439+a, gdbSNP:74390714
1438+c, tdbSNP:72546695
1439+a, gdbSNP:17183890
complement(1467)-dbSNP:
complement(1467)-t, cdbSNP:199990599
complement(1481)-t, gdbSNP:148468264
complement(1482)-g, adbSNP:201787969
complement(1491)-t, cdbSNP:200780530
complement(1523)-t, cdbSNP:200166474
complement(1528)-g, adbSNP:201450363
1535+a, gdbSNP:72546694
complement(1566)-t, cdbSNP:200768845
complement(1628)-dbSNP:
complement(1628)-t, cdbSNP:199832213
complement(1686)-t, gdbSNP:201448262
complement(1701)-dbSNP:
complement(1701)-t, cdbSNP:200882593
complement(1737)-g, adbSNP:373857327
complement(1815)-dbSNP:
complement(1815)-t, cdbSNP:200373768
complement(1898)-dbSNP:
complement(1898)-t, cdbSNP:200536812
complement(1912)-t, cdbSNP:201101443
complement(1913)-t, adbSNP:34009575
complement(1922)-t, cdbSNP:201844866
complement(1932)-dbSNP:
complement(1932)-c, adbSNP:140668532
complement(1977)-g, adbSNP:199730714
1978+a, gdbSNP:72548709
complement(1982)-t, cdbSNP:375157934
complement(2002)-g, adbSNP:370810641
2036+a, gdbSNP:17183904
complement(2068)-t, cdbSNP:367873946
complement(2075)-t, cdbSNP:201351290
complement(2088)-t, cdbSNP:201790494
complement(2091)-g, cdbSNP:374033612
2093+c, tdbSNP:17183897
complement(2097)-g, adbSNP:201871343
complement(2139)-dbSNP:
complement(2139)-g, cdbSNP:376972717
complement(2164)-t, cdbSNP:201010589
complement(2170)-t, cdbSNP:149631706
complement(2190)-t, cdbSNP:200933546
complement(2192)-g, adbSNP:373522752
complement(2193)-t, gdbSNP:369649606
complement(2205)-t, cdbSNP:201103601
complement(2212)-g, adbSNP:139402886
2213+a, gdbSNP:72548719
complement(2235)-dbSNP:
complement(2235)-g, adbSNP:202055878
complement(2236)-t, cdbSNP:141519181
complement(2246)-g, cdbSNP:138983843
complement(2258)-g, adbSNP:371831950
complement(2264)-t, cdbSNP:368693848
complement(2268)-c, adbSNP:201770515
complement(2279)-g, adbSNP:146200772
complement(2287)-g, adbSNP:141641235
complement(2294)-t, cdbSNP:202040450
complement(2315)-t, cdbSNP:199546717
complement(2374)-t, cdbSNP:199859509
complement(2387)-t, cdbSNP:201590431
complement(2395)-g, adbSNP:200620630
2414+c, tdbSNP:72548714
2423..2425+, attdbSNP:72548715
complement(2493)-t, cdbSNP:370966100
2552+c, tdbSNP:72548716
2554+a, gdbSNP:72548717
complement(2647)-t, cdbSNP:4331700
complement(2671)-t, cdbSNP:372065817
2703+a, gdbSNP:66753817
complement(2722)-g, cdbSNP:186981433
2768+a, gdbSNP:68194015
2770+a, gdbSNP:67881446
2771+a, gdbSNP:67889588
complement(2792..2794)-, aatdbSNP:372898074
complement(2798)-g, adbSNP:111356766
complement(2872)-t, cdbSNP:375571367
complement(2918)-t, cdbSNP:4331699
complement(2985)-g, adbSNP:181105632
3037+a, gdbSNP:72548718
complement(3130)-t, cdbSNP:188729062
complement(3156)-t, cdbSNP:148679423
complement(3162)-c, adbSNP:183675338
complement(3180)-g, cdbSNP:77368793
complement(3305)-t, cdbSNP:2037547
complement(3309)-t, cdbSNP:180780479
complement(3315)-c, adbSNP:189300766
complement(3325)-g, adbSNP:75575079
complement(3421)-g, adbSNP:79610052
complement(3463)-t, cdbSNP:185646830
complement(3580)-t, cdbSNP:112822116
complement(3596..3597)-, adbSNP:199790427
complement(3596)-, adbSNP:150696846
complement(3617)-t, gdbSNP:144189446
complement(3668)-g, cdbSNP:149350172
complement(3675)-c, adbSNP:370827005
complement(3776)-t, gdbSNP:73175828
complement(3986)-g, adbSNP:61570807
complement(3997)-, gdbSNP:34679567
complement(3999)-t, cdbSNP:55910624
complement(4272)-g, adbSNP:138830070
complement(4283)-g, adbSNP:145047652
complement(4369)-t, cdbSNP:193147776
complement(4384)-g, adbSNP:142829558
complement(4387)-t, cdbSNP:188475324
complement(4477)-g, adbSNP:138341826
complement(4567)-t, cdbSNP:368437717
complement(4593)-g, cdbSNP:150443898
complement(4643)-g, cdbSNP:184371124
complement(4686)-g, cdbSNP:140556617
complement(4721..4724)-, acacdbSNP:3835183
complement(4721..4722)-, acdbSNP:56707568
complement(4729..4732)-, acacdbSNP:71729209
complement(4740..4743)-, cacadbSNP:10546859
complement(4742..4743)-, cadbSNP:143120054
complement(4875)-g, adbSNP:151325099
complement(4911..4912)-, ttdbSNP:201745461
complement(5049..5050)-, gdbSNP:35607137
complement(5073)-t, cdbSNP:191540673
complement(5153)-t, adbSNP:76949365
complement(5192)-g, adbSNP:114395791
complement(5204)-t, cdbSNP:55644728
complement(5330)-t, cdbSNP:187094684
complement(5548)-g, cdbSNP:182635086
complement(5554..5555)-, gadbSNP:141933496
complement(5588)-g, adbSNP:190976553
complement(5615)-g, cdbSNP:187749667
complement(5623)-g, adbSNP:3732361
complement(5631)-t, cdbSNP:184049790
complement(5730)-g, c, adbSNP:56728675
complement(5796)-t, adbSNP:60393216
complement(5869)-t, cdbSNP:373481195
complement(6016)-, adbSNP:59824213
complement(6055)-g, adbSNP:373001600
complement(6145)-c, adbSNP:191981565
complement(6196)-t, gdbSNP:185949833
complement(6253)-c, adbSNP:181660262
complement(6478)-t, cdbSNP:143580214
complement(6599)-t, cdbSNP:111478298
complement(6610)-g, cdbSNP:190739224
complement(6805..6806)-, tadbSNP:71156775
complement(6807)-t, adbSNP:185634268
complement(6827..6828)-, atdbSNP:142080058
complement(6828..6829)-, tadbSNP:369943074
complement(6828..6829)-, tadbSNP:386356268
complement(6943..6944)-, aadbSNP:397965366
complement(6952..6953)-, a, aadbSNP:59156758
complement(7038)-t, cdbSNP:181430681
Gene SymbolGSK3B
Gene SynonymGSK3B
Chromosome3
Locus Map3q13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001146156 Homo sapiens glycogen synthase kinase 3 beta (GSK3B), transcript variant 2, mRNA. On-demand $699.00 18
NM_002093 Homo sapiens glycogen synthase kinase 3 beta (GSK3B), transcript variant 1, mRNA. In-stock $509.00 $460.00 12
XM_006713610 PREDICTED: Homo sapiens glycogen synthase kinase 3 beta (GSK3B), transcript variant X1, mRNA. On-demand $549.00 14
XM_006713611 PREDICTED: Homo sapiens glycogen synthase kinase 3 beta (GSK3B), transcript variant X2, mRNA. On-demand $549.00 14
Title GSK-3beta protein phosphorylates and stabilizes HLXB9 protein in insulinoma cells to form a targetable mechanism of controlling insulinoma cell proliferation .
Author Desai SS, Modali SD, Parekh VI, Kebebew E and Agarwal SK.
Journal J. Biol. Chem. 289 (9), 5386-5398 (2014)
Title A colon cancer-derived mutant of Kruppel-like factor 5 (KLF5) is resistant to degradation by glycogen synthase kinase 3beta (GSK3beta) and the E3 ubiquitin ligase F-box and WD repeat domain-containing 7alpha (FBW7alpha) .
Author Bialkowska AB, Liu Y, Nandan MO and Yang VW.
Journal J. Biol. Chem. 289 (9), 5997-6005 (2014)
Title GSK3beta negatively regulates HIF1alpha mRNA stability via nucleolin in the MG63 osteosarcoma cell line .
Author Cheng DD, Zhao HG, Yang YS, Hu T and Yang QC.
Journal Biochem. Biophys. Res. Commun. 443 (2), 598-603 (2014)
Title Octreotide stimulates somatostatin receptor-induced apoptosis of SW480 colon cancer cells by activation of glycogen synthase kinase-3beta, A Wnt/beta-catenin pathway modulator .
Author Wang,S., Bao,Z., Liang,Q.M., Long,J.W., Xiao,Z.S., Jiang,Z.J., Liu,B., Yang,J. and Long,Z.X.
Journal Hepatogastroenterology 60 (127), 1639-1646 (2013)
Title [The relationship between glycogen synthase kinase - 3beta -1727A/T x -50T/C genetic polymorphisms and nicotine dependence] .
Author Numajiri M, Nishizawa D, Ikeda K, Yoshihara E and Iwahashii K.
Journal Nihon Arukoru Yakubutsu Igakkai Zasshi 48 (5), 293-299 (2013)
Title Glycogen synthase kinase-3: functions in oncogenesis and development .
Author Plyte SE, Hughes K, Nikolakaki E, Pulverer BJ and Woodgett JR.
Journal Biochim. Biophys. Acta 1114 (2-3), 147-162 (1992)
Title p42 MAP kinase phosphorylation sites in microtubule-associated protein tau are dephosphorylated by protein phosphatase 2A1. Implications for Alzheimer's disease [corrected] .
Author Goedert M, Cohen ES, Jakes R and Cohen P.
Journal FEBS Lett. 312 (1), 95-99 (1992)
Title Differential regulation of glycogen synthase kinase-3 beta by protein kinase C isotypes .
Author Goode N, Hughes K, Woodgett JR and Parker PJ.
Journal J. Biol. Chem. 267 (24), 16878-16882 (1992)
Title Glycogen synthase from rabbit skeletal muscle. Amino acid sequence at the sites phosphorylated by glycogen synthase kinase-3, and extension of the N-terminal sequence containing the site phosphorylated by phosphorylase kinase .
Author Rylatt,D.B., Aitken,A., Bilham,T., Condon,G.D., Embi,N. and Cohen,P.
Journal Eur. J. Biochem. 107 (2), 529-537 (1980)
Title Proceedings: Aneurysmal bone cysts of the spine .
Author Ameli,N.O., Teymoorian,G.A., Saleh,H. and Slamdoost,A.
Journal Acta Neurochir (Wien) 31 (3-4), 273 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.