• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glycogen synthase 1 (muscle) (GYS1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19222 Homo sapiens glycogen synthase 1 (muscle) (GYS1), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19222C Homo sapiens glycogen synthase 1 (muscle) (GYS1), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002103.4, 239049506
Length 2214 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens glycogen synthase 1 (muscle) (GYS1), transcript variant 1, mRNA.
Product glycogen [starch] synthase, muscle isoform 1
Comment

Summary: The protein encoded by this gene catalyzes the addition of glucose monomers to the growing glycogen molecule through the formation of alpha-1,4-glycoside linkages. Mutations in this gene are associated with muscle glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_002094.2
CDS 242..2455
Misc Feature(1)47..49
Misc Feature(2)47..49
Misc Feature(3)263..265
Misc Feature(4)263..265
Misc Feature(5)269..271
Misc Feature(6)317..2086
Misc Feature(7)332..2230
Misc Feature(8)2162..2164
Misc Feature(9)2162..2164
Misc Feature(10)2174..2176
Misc Feature(11)2174..2176
Misc Feature(12)2180..2182
Misc Feature(13)2186..2188
Misc Feature(14)2186..2188
Misc Feature(15)2195..2197
Misc Feature(16)2198..2200
Misc Feature(17)2198..2200
Misc Feature(18)2333..2335
Misc Feature(19)2342..2344
Misc Feature(20)2369..2371
Misc Feature(21)2378..2380
Misc Feature(22)2384..2386
Misc Feature(23)2387..2389
Misc Feature(24)2390..2392
Misc Feature(25)2393..2395
Misc Feature(26)2399..2401
Misc Feature(27)2420..2422
Misc Feature(28)2420..2422
Misc Feature(29)2426..2428
Misc Feature(30)2429..2431
Misc Feature(31)2432..2434
Exon (1)1..359
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (2)360..541
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (3)542..733
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (4)734..919
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (5)920..1064
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (6)1065..1182
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (7)1183..1303
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (8)1304..1410
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (9)1411..1470
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (10)1471..1549
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (11)1550..1663
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (12)1664..1790
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (13)1791..1886
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (14)1887..2050
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (15)2051..2131
Gene:GYS1
Gene Synonym:GSY; GYS
Exon (16)2132..3618
Gene:GYS1
Gene Synonym:GSY; GYS
Translation MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD NYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY LGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE EDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLS TPSEPLSPTSSLGEERN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(60)-c, adbSNP:2287755
complement(117)-g, adbSNP:2287754
complement(191)-g, adbSNP:200931260
complement(194)-g, cdbSNP:201550075
complement(200)-g, adbSNP:370809454
complement(214)-t, gdbSNP:377543851
complement(216)-g, adbSNP:202114467
complement(223)-t, gdbSNP:2287753
complement(223)-t, gdbSNP:386563710
complement(251)-t, cdbSNP:199602884
complement(314)-t, cdbSNP:373514421
complement(441)-dbSNP:
complement(441)-g, adbSNP:376369611
complement(442)-t, cdbSNP:140201404
complement(454)-g, cdbSNP:200998100
complement(458)-t, cdbSNP:370035815
460+c, gdbSNP:1042152
complement(469)-g, cdbSNP:78808523
complement(475)-t, cdbSNP:146683677
complement(492)-g, adbSNP:143186691
complement(495)-g, adbSNP:140774115
complement(496)-t, cdbSNP:146417520
complement(512)-g, adbSNP:143197745
complement(542)-dbSNP:
complement(542)-c, adbSNP:374358945
565+c, g, tdbSNP:5455
complement(595)-g, adbSNP:374959862
629+a, gdbSNP:5456
complement(636)-t, cdbSNP:183816843
646+c, tdbSNP:5457
648+c, tdbSNP:1126525
complement(661)-g, adbSNP:5458
complement(674)-t, cdbSNP:200057871
complement(682)-t, cdbSNP:115793204
complement(688)-g, adbSNP:200642005
complement(718)-g, cdbSNP:144548792
complement(775)-dbSNP:
complement(775)-g, adbSNP:140832609
complement(779..780)-, gdbSNP:35671121
complement(788)-g, adbSNP:147264448
complement(794)-t, cdbSNP:201248933
complement(796)-t, cdbSNP:2229612
complement(797)-t, cdbSNP:138330298
complement(806)-g, adbSNP:375002849
complement(818)-t, cdbSNP:371010603
complement(872)-g, adbSNP:150822415
complement(886)-g, adbSNP:371721154
complement(887)-t, cdbSNP:141601517
complement(891)-g, adbSNP:148365002
complement(902)-c, adbSNP:200703195
complement(903)-t, cdbSNP:369013328
complement(907)-g, cdbSNP:201548356
complement(925)-dbSNP:
complement(925)-g, adbSNP:202167827
complement(934)-g, adbSNP:5460
complement(963)-t, cdbSNP:192597341
982+a, gdbSNP:3745692
complement(995)-t, cdbSNP:376523274
complement(1000)-g, adbSNP:149182914
complement(1028)-t, cdbSNP:372637032
complement(1034)-t, cdbSNP:138606563
complement(1089)-dbSNP:
complement(1089)-t, cdbSNP:386598736
complement(1089)-g, adbSNP:5461
complement(1179)-t, cdbSNP:200544361
complement(1183)-dbSNP:
complement(1183)-t, cdbSNP:369803997
complement(1228)-g, adbSNP:180906371
1261+c, tdbSNP:13306415
1267+c, tdbSNP:5464
complement(1310)-dbSNP:
complement(1310)-t, cdbSNP:146437672
1317+a, gdbSNP:5465
complement(1317)-t, cdbSNP:386598747
complement(1324)-t, cdbSNP:149865396
complement(1337)-g, adbSNP:140397352
complement(1351)-t, cdbSNP:200386346
complement(1353)-t, cdbSNP:369847599
complement(1362)-t, cdbSNP:200672892
complement(1417)-dbSNP:
complement(1417)-t, cdbSNP:151212573
complement(1435)-t, cdbSNP:375010111
complement(1441)-g, adbSNP:146814405
1487+dbSNP:
1487+a, gdbSNP:5447
complement(1528)-t, cdbSNP:374232414
complement(1546)-t, cdbSNP:147610727
complement(1550)-dbSNP:
complement(1550)-t, gdbSNP:369143238
complement(1565)-g, cdbSNP:142951866
complement(1573)-g, adbSNP:377125421
complement(1579)-g, adbSNP:139974904
1625+c, tdbSNP:121434584
complement(1631)-t, cdbSNP:200862074
complement(1657)-t, cdbSNP:138480890
complement(1677)-dbSNP:
complement(1677)-g, adbSNP:144681053
complement(1753)-g, adbSNP:201028159
1786+a, gdbSNP:5448
complement(1786)-g, adbSNP:386598700
complement(1792)-dbSNP:
complement(1792)-c, adbSNP:368021148
complement(1830)-t, cdbSNP:374401394
complement(1913)-dbSNP:
complement(1913)-t, gdbSNP:370992600
complement(1923)-t, cdbSNP:375027132
complement(1990)-t, gdbSNP:146698792
complement(2003)-g, cdbSNP:377063513
complement(2020)-g, adbSNP:372542706
complement(2049)-g, cdbSNP:143040823
complement(2072)-dbSNP:
complement(2072)-t, cdbSNP:138443659
complement(2089)-g, adbSNP:145789213
complement(2096)-g, cdbSNP:5450
complement(2124)-g, adbSNP:371546215
complement(2131)-t, cdbSNP:142457302
complement(2144)-dbSNP:
complement(2144)-t, gdbSNP:373111758
complement(2145)-t, cdbSNP:200113836
complement(2163)-g, adbSNP:137913986
complement(2167)-g, adbSNP:5451
complement(2195)-g, adbSNP:111534393
complement(2236)-g, adbSNP:201072036
complement(2254)-t, cdbSNP:5452
complement(2255)-t, cdbSNP:145448665
complement(2267)-g, cdbSNP:200945760
complement(2284)-g, adbSNP:142265031
complement(2288)-t, cdbSNP:141845425
complement(2312)-g, cdbSNP:5453
complement(2316)-t, cdbSNP:369846298
complement(2333)-g, adbSNP:147627546
complement(2340)-g, adbSNP:376847475
complement(2353)-g, adbSNP:371968970
2357+a, cdbSNP:1042160
complement(2364)-t, cdbSNP:112195498
complement(2448)-t, cdbSNP:367919986
complement(2477)-t, cdbSNP:369405685
complement(2490)-g, adbSNP:78559163
complement(2531..2532)-, tdbSNP:34266250
2538+a, cdbSNP:1042161
2552+g, tdbSNP:1042162
complement(2558)-t, cdbSNP:386512875
2558+c, tdbSNP:1042163
complement(2580)-t, adbSNP:185997302
complement(2601)-g, cdbSNP:113438180
complement(2606)-t, cdbSNP:77955757
complement(2676)-t, cdbSNP:183140598
complement(2711)-t, cdbSNP:148077948
complement(2745)-g, adbSNP:191492279
complement(2756)-t, cdbSNP:147489255
complement(2825)-t, gdbSNP:185366453
complement(2850)-g, adbSNP:112850979
2860+a, gdbSNP:143143116
complement(2876)-t, cdbSNP:181566066
2905+a, gdbSNP:3745693
complement(3066)-g, adbSNP:370792196
complement(3114)-g, adbSNP:367578611
3180+c, tdbSNP:1042265
complement(3296)-t, cdbSNP:75797604
complement(3363)-t, cdbSNP:117997270
complement(3475)-g, adbSNP:371088971
3553+a, gdbSNP:1042336
complement(3568..3571)-, cactdbSNP:148396922
Gene SymbolGYS1
Gene SynonymGSY; GYS
Chromosome19
Locus Map19q13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001161587 Homo sapiens glycogen synthase 1 (muscle) (GYS1), transcript variant 2, mRNA. In-stock $99.00 5-7
NM_002103 Homo sapiens glycogen synthase 1 (muscle) (GYS1), transcript variant 1, mRNA. In-stock $99.00 5-7
Title Genome-wide association study of sex hormones, gonadotropins and sex hormone-binding protein in Chinese men .
Author Chen Z, Tao S, Gao Y, Zhang J, Hu Y, Mo L, Kim ST, Yang X, Tan A, Zhang H, Qin X, Li L, Wu Y, Zhang S, Zheng SL, Xu J, Mo Z and Sun J.
Journal J. Med. Genet. 50 (12), 794-801 (2013)
Title Akt2 influences glycogen synthase activity in human skeletal muscle through regulation of NH(2)-terminal (sites 2 + 2a) phosphorylation .
Author Friedrichsen M, Birk JB, Richter EA, Ribel-Madsen R, Pehmoller C, Hansen BF, Beck-Nielsen H, Hirshman MF, Goodyear LJ, Vaag A, Poulsen P and Wojtaszewski JF.
Journal Am. J. Physiol. Endocrinol. Metab. 304 (6), E631-E639 (2013)
Title Regulation of glycogen synthase from mammalian skeletal muscle--a unifying view of allosteric and covalent regulation .
Author Palm DC, Rohwer JM and Hofmeyr JH.
Journal FEBS J. 280 (1), 2-27 (2013)
Title GLUT4 and glycogen synthase are key players in bed rest-induced insulin resistance .
Author Bienso RS, Ringholm S, Kiilerich K, Aachmann-Andersen NJ, Krogh-Madsen R, Guerra B, Plomgaard P, van Hall G, Treebak JT, Saltin B, Lundby C, Calbet JA, Pilegaard H and Wojtaszewski JF.
Journal Diabetes 61 (5), 1090-1099 (2012)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B, Yusuf S, Gerstein HC, Engert JC and Anand S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Isolation and characterization of the human muscle glycogen synthase gene .
Author Orho M, Nikula-Ijas P, Schalin-Jantti C, Permutt MA and Groop LC.
Journal Diabetes 44 (9), 1099-1105 (1995)
Title Increased concentrations of glycogen synthase protein in skeletal muscle of patients with NIDDM .
Author Lofman M, Yki-Jarvinen H, Parkkonen M, Lindstrom J, Koranyi L, Schalin-Jantti C and Groop L.
Journal Am. J. Physiol. 269 (1 PT 1), E27-E32 (1995)
Title Phosphate groups as substrate determinants for casein kinase I action .
Author Flotow H, Graves PR, Wang AQ, Fiol CJ, Roeske RW and Roach PJ.
Journal J. Biol. Chem. 265 (24), 14264-14269 (1990)
Title Human muscle glycogen synthase cDNA sequence: a negatively charged protein with an asymmetric charge distribution .
Author Browner MF, Nakano K, Bang AG and Fletterick RJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 86 (5), 1443-1447 (1989)
Title Glycogen synthase from rabbit skeletal muscle. Amino acid sequence at the sites phosphorylated by glycogen synthase kinase-3, and extension of the N-terminal sequence containing the site phosphorylated by phosphorylase kinase .
Author Rylatt,D.B., Aitken,A., Bilham,T., Condon,G.D., Embi,N. and Cohen,P.
Journal Eur. J. Biochem. 107 (2), 529-537 (1980)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.