• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens major histocompatibility complex, class I, C (HLA-C), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_002117 Homo sapiens major histocompatibility complex, class I, C (HLA-C), transcript variant 1, mRNA. ORF Sequence $319.29
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002117.5, 339882742
Length 1586 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens major histocompatibility complex, class I, C (HLA-C), transcript variant 1, mRNA.
Product HLA class I histocompatibility antigen, Cw-1 alpha chain precursor
Comment

Summary: HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Over one hundred HLA-C alleles have been described [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the C*07:02:01 allele of the HLA-C gene, as represented in the assembled chromosome 6 in the primary assembly of the reference genome.

RefSeq NP_002108.4
CDS 66..1166
Misc Feature(1)138..407
Misc Feature(2)141..674
Misc Feature(3)393..395
Misc Feature(4)408..683
Misc Feature(5)684..962
Misc Feature(6)684..959
Misc Feature(7)order(741..743,747..749,828..833,837..845,861..863,
Misc Feature(8)order(762..770,852..854,927..929)
Misc Feature(9)960..989
Misc Feature(10)990..1064
Exon (1)1..138
Gene:HLA-C
Gene Synonym:D6S204; HLA-JY3; HLC-C; PSORS1
Exon (2)139..408
Gene:HLA-C
Gene Synonym:D6S204; HLA-JY3; HLC-C; PSORS1
Exon (3)409..684
Gene:HLA-C
Gene Synonym:D6S204; HLA-JY3; HLC-C; PSORS1
Exon (4)685..960
Gene:HLA-C
Gene Synonym:D6S204; HLA-JY3; HLC-C; PSORS1
Exon (5)961..1080
Gene:HLA-C
Gene Synonym:D6S204; HLA-JY3; HLC-C; PSORS1
Exon (6)1081..1113
Gene:HLA-C
Gene Synonym:D6S204; HLA-JY3; HLC-C; PSORS1
Exon (7)1114..1161
Gene:HLA-C
Gene Synonym:D6S204; HLA-JY3; HLC-C; PSORS1
Exon (8)1162..1586
Gene:HLA-C
Gene Synonym:D6S204; HLA-JY3; HLC-C; PSORS1
Translation MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRF DSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQ RMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQL RAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEP SSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDES LITCKA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(2)-dbSNP:
complement(2)-t, gdbSNP:115120050
18+a, gdbSNP:2074491
complement(24..30)-, gactgggdbSNP:200353551
30+, cdbSNP:281860315
complement(45..46)-gt, ccdbSNP:71533838
45+a, gdbSNP:2074492
complement(46)-g, cdbSNP:9264674
complement(59)-g, cdbSNP:7767581
complement(70)-g, cdbSNP:147432710
complement(76)-g, adbSNP:199783871
complement(79)-c, adbSNP:1065366
complement(83)-g, cdbSNP:11547352
84+c, tdbSNP:41548414
85+a, gdbSNP:41548123
complement(85)-g, adbSNP:1065367
87+a, gdbSNP:2308525
89+c, tdbSNP:41543119
93+a, cdbSNP:2308527
94+c, tdbSNP:41562218
112+c, g, tdbSNP:1050451
complement(119)-t, cdbSNP:11547349
121+a, tdbSNP:281860316
complement(124)-t, cdbSNP:1131153
124+c, tdbSNP:41549413
125+c, tdbSNP:72558133
135+a, gdbSNP:41553415
138+g, tdbSNP:2074493
complement(138)-c, adbSNP:74223616
139+dbSNP:
139+c, gdbSNP:281860318
141+g, tdbSNP:41546415
142+a, cdbSNP:281860319
complement(143)-g, c, adbSNP:200202980
144+c, tdbSNP:79057049
145+a, gdbSNP:281860320
146+c, g, tdbSNP:41543915
148+a, c, tdbSNP:11547360
149+c, g, tdbSNP:281860321
150+a, cdbSNP:281860322
151+a, tdbSNP:61759936
153+a, gdbSNP:281860323
154+a, g, tdbSNP:1131151
155+a, c, g, tdbSNP:41548017
156+c, g, tdbSNP:281860324
157+, adbSNP:281860325
157+a, gdbSNP:281860326
158+c, tdbSNP:281860327
159+a, tdbSNP:281860328
161+a, c, tdbSNP:281860329
complement(162)-g, c, adbSNP:9264668
163+a, c, g, tdbSNP:1071650
165+a, c, gdbSNP:281860330
166+c, tdbSNP:281860331
167+a, cdbSNP:1050446
168+g, tdbSNP:1050445
169+c, tdbSNP:72558124
170+c, g, tdbSNP:1050444
171+a, c, g, tdbSNP:2308538
172+a, tdbSNP:41557119
173+a, c, gdbSNP:61759937
175+a, cdbSNP:281860332
177+c, g, tdbSNP:281860333
178+a, gdbSNP:72558134
179+a, gdbSNP:281860334
180+a, cdbSNP:41558512
181+c, tdbSNP:281860335
182+c, g, tdbSNP:281860336
183+a, c, g, tdbSNP:281860337
186+a, c, gdbSNP:41555420
187+a, c, g, tdbSNP:41560916
complement(188)-g, adbSNP:199830079
189+c, g, tdbSNP:281860338
190+a, c, g, tdbSNP:45574634
191+a, gdbSNP:41542719
192+a, c, gdbSNP:1050438
193+a, tdbSNP:281860339
196+a, c, g, tdbSNP:281860340
198+c, tdbSNP:72558135
199+a, gdbSNP:1050437
201+a, g, tdbSNP:281860341
203+c, tdbSNP:41554619
206+c, tdbSNP:41564220
207+a, c, g, tdbSNP:707911
209+a, c, gdbSNP:16895957
212+a, gdbSNP:281860342
213+a, gdbSNP:281860343
214+a, gdbSNP:281860344
215+a, cdbSNP:281860345
216+a, tdbSNP:281860346
218+a, c, tdbSNP:281860347
219+a, c, gdbSNP:41561612
222+a, gdbSNP:75512631
223+a, gdbSNP:281860348
224+c, gdbSNP:281860349
225+c, g, tdbSNP:72558126
227+c, tdbSNP:281860350
229+c, tdbSNP:281860351
230+a, c, gdbSNP:16895963
231+c, tdbSNP:281860352
232+a, gdbSNP:41545521
235+c, g, tdbSNP:281860353
236+c, tdbSNP:41555812
237+a, c, gdbSNP:281860354
238+a, c, g, tdbSNP:77670405
239+a, gdbSNP:281860355
240+a, c, tdbSNP:281860356
241+a, c, gdbSNP:1050428
242+a, gdbSNP:281860357
243+c, tdbSNP:281860358
244+c, tdbSNP:41550118
245+c, g, tdbSNP:281860359
246+a, c, gdbSNP:281860360
248+c, tdbSNP:281860361
250+a, gdbSNP:281860362
251+a, c, gdbSNP:281860363
252+a, g, tdbSNP:281860364
254+a, c, tdbSNP:281860365
255+a, gdbSNP:281860366
257+a, c, g, tdbSNP:281860367
258+a, gdbSNP:77850534
259+c, g, tdbSNP:281860368
261+a, gdbSNP:281860369
262+a, gdbSNP:79777994
complement(263)-g, adbSNP:146215372
264+c, g, tdbSNP:12721931
266+a, gdbSNP:1050420
267+a, g, tdbSNP:281860370
268+c, gdbSNP:72558130
269+a, gdbSNP:72558131
complement(270)-t, cdbSNP:201563781
271+a, c, g, tdbSNP:41548913
272+a, gdbSNP:1065380
274+a, c, gdbSNP:281860371
275+a, gdbSNP:281860372
276+c, g, tdbSNP:281860373
277+c, gdbSNP:281860374
278+c, gdbSNP:1050414
279+a, c, tdbSNP:281860375
281+a, c, g, tdbSNP:11547353
282+a, g, tdbSNP:72558132
283+a, c, gdbSNP:1050409
284+g, tdbSNP:281860376
285+c, tdbSNP:41551015
286+c, g, tdbSNP:41546817
287+a, gdbSNP:281860377
291+a, g, tdbSNP:1065382
293+a, gdbSNP:1065384
297..299+, cagdbSNP:281860378
298+a, g, tdbSNP:281860379
299+, gdbSNP:281860380
300+a, c, gdbSNP:77429690
301+a, tdbSNP:281860381
302+a, gdbSNP:281860382
303+c, g, tdbSNP:281860383
304+a, c, gdbSNP:41540214
305+a, g, tdbSNP:281860384
306+a, c, tdbSNP:281860385
307+a, c, g, tdbSNP:72558136
308+a, c, gdbSNP:72558137
309+a, c, gdbSNP:41559013
311+a, g, tdbSNP:281860386
312+a, tdbSNP:281860387
313+a, gdbSNP:281860388
314+c, g, tdbSNP:281860389
316+a, gdbSNP:281860390
317+a, gdbSNP:281860391
318+c, gdbSNP:281860392
319+a, gdbSNP:281860393
320+c, tdbSNP:281860394
321+c, g, tdbSNP:45438695
322+a, c, g, tdbSNP:281860395
323+a, c, gdbSNP:61759940
324+a, c, gdbSNP:1065385
326+c, gdbSNP:281860396
327+a, cdbSNP:281860397
329+a, gdbSNP:41555917
330+a, c, gdbSNP:281860398
331+a, tdbSNP:281860399
332+a, gdbSNP:281860400
complement(335)-g, c, adbSNP:28626310
339+a, gdbSNP:281860401
340+a, gdbSNP:281860402
341+a, c, gdbSNP:281860403
342+a, c, tdbSNP:74972087
343+a, gdbSNP:45609431
345+c, tdbSNP:76638752
346+a, gdbSNP:281860404
348+a, g, tdbSNP:281860405
349+c, tdbSNP:281860406
352+a, cdbSNP:45500292
353+c, g, tdbSNP:281860407
354+a, gdbSNP:41543814
356+a, tdbSNP:281860408
357+c, gdbSNP:281860409
359+c, tdbSNP:281860410
360+a, c, g, tdbSNP:41549514
361+a, c, gdbSNP:11547351
364+a, tdbSNP:41550619
365+a, g, tdbSNP:281860411
366+a, g, tdbSNP:41559713
367+a, c, g, tdbSNP:2308557
368+a, c, tdbSNP:281860412
369+c, tdbSNP:281860413
370+c, g, tdbSNP:281860414
372+c, tdbSNP:281860415
373+a, c, gdbSNP:281860416
374+a, gdbSNP:281860417
375+a, c, gdbSNP:281860418
376+a, gdbSNP:281860419
377+a, c, tdbSNP:17408553
380+a, gdbSNP:41549919
381+c, tdbSNP:281860420
382+a, g, tdbSNP:281860421
383+c, tdbSNP:281860422
384+a, c, gdbSNP:281860423
387+c, tdbSNP:77376497
388+a, gdbSNP:45501796
389+c, tdbSNP:281860424
391+a, gdbSNP:281860425
392+a, c, tdbSNP:41558820
393+a, gdbSNP:281860426
395+a, c, tdbSNP:281860427
396+c, tdbSNP:281860428
397+a, gdbSNP:281860429
398+a, c, gdbSNP:281860430
400+a, gdbSNP:281860431
401+c, g, tdbSNP:281860432
402+a, gdbSNP:281860433
404+c, gdbSNP:281860434
405+a, g, tdbSNP:281860435
406+a, c, tdbSNP:1131123
407+a, c, tdbSNP:281860436
408+a, c, gdbSNP:1131122
409+dbSNP:
409+, gdbSNP:281860439
410+, gdbSNP:281860440
410+g, tdbSNP:41543218
411+g, tdbSNP:41563413
412+a, c, gdbSNP:41548520
413+g, tdbSNP:281860441
415+a, tdbSNP:41560716
416+a, c, tdbSNP:281860442
417+a, gdbSNP:281860443
418+a, c, tdbSNP:1131119
complement(419)-g, c, adbSNP:201542001
420+a, c, tdbSNP:1071649
421+a, c, g, tdbSNP:41546913
complement(422)-t, g, c, adbSNP:201441823
424+a, gdbSNP:281860444
425+a, gdbSNP:281860445
426+a, c, g, tdbSNP:1131118
427+a, c, g, tdbSNP:2308567
428+a, c, g, tdbSNP:41556316
429+a, g, tdbSNP:281860446
430+c, g, tdbSNP:281860447
431+a, gdbSNP:281860448
432+c, g, tdbSNP:281860449
433+a, c, g, tdbSNP:1131115
434+a, c, g, tdbSNP:1131114
436+a, gdbSNP:281860450
437+c, tdbSNP:41563216
438+a, tdbSNP:281860451
439+a, gdbSNP:41564314
440+a, c, tdbSNP:281860452
441+a, g, tdbSNP:45619135
443+a, cdbSNP:281860453
complement(444)-g, c, adbSNP:34592426
446+g, tdbSNP:281860454
447+a, gdbSNP:281860455
448+a, c, gdbSNP:281860456
449+a, g, tdbSNP:41540712
450+a, c, tdbSNP:41546215
451+a, cdbSNP:281860457
452+a, c, gdbSNP:1050384
453+a, c, g, tdbSNP:41544015
455+a, c, g, tdbSNP:45558335
456+a, c, g, tdbSNP:77244469
457+c, gdbSNP:281860458
458+a, c, gdbSNP:281860459
459+a, c, g, tdbSNP:281860460
460+a, g, tdbSNP:281860461
461+a, c, tdbSNP:41563421
complement(462)-g, c, adbSNP:201232509
464+c, tdbSNP:41554814
465+c, g, tdbSNP:281860462
467+c, gdbSNP:281860463
468+c, tdbSNP:281860464
469+a, g, tdbSNP:281860465
470+c, tdbSNP:281860466
471+a, c, gdbSNP:41562320
complement(472)-g, c, adbSNP:182798226
473+a, c, g, tdbSNP:45626438
474+a, c, tdbSNP:2308574
475+a, g, tdbSNP:41555122
476+c, g, tdbSNP:41562313
477+a, c, gdbSNP:2308575
complement(477)-t, cdbSNP:77930988
478+a, g, tdbSNP:41542424
479+a, c, g, tdbSNP:281860467
480+c, tdbSNP:281860468
481+a, gdbSNP:281860469
483+g, tdbSNP:41553719
484+a, c, tdbSNP:713032
complement(484)-g, adbSNP:76583609
485+a, c, g, tdbSNP:1065406
486+c, g, tdbSNP:61759941
487+c, tdbSNP:281860470
490+a, gdbSNP:281860471
complement(491)-t, g, c, adbSNP:200172948
492+a, c, g, tdbSNP:72558147
494+a, c, g, tdbSNP:281860472
495+a, c, g, tdbSNP:45580333
496+g, tdbSNP:41551916
497+c, tdbSNP:281860473
499+a, g, tdbSNP:281860474
complement(500)-t, cdbSNP:201375064
501+a, gdbSNP:281860475
502+a, tdbSNP:281860476
504+c, tdbSNP:281860477
505+a, tdbSNP:281860478
506+c, g, tdbSNP:281860479
508+a, tdbSNP:281860480
510+a, g, tdbSNP:281860481
511+a, c, tdbSNP:41550023
512+c, tdbSNP:281860482
513+c, tdbSNP:281860483
514+a, tdbSNP:41541817
518+a, c, tdbSNP:1050373
complement(518)-g, adbSNP:74470880
519+a, c, g, tdbSNP:281860484
520+a, tdbSNP:281860485
521+a, gdbSNP:281860486
522+a, c, g, tdbSNP:281860487
complement(523)-t, g, c, adbSNP:17850337
complement(524)-t, cdbSNP:17839985
524+c, tdbSNP:1050371
526+a, c, tdbSNP:281860488
527+a, gdbSNP:41557216
528+a, g, tdbSNP:76907552
529+a, c, g, tdbSNP:281860489
530+a, cdbSNP:281860490
532+c, tdbSNP:41542612
533+c, g, tdbSNP:281860491
536+c, gdbSNP:281860492
537+a, gdbSNP:78897778
538+c, tdbSNP:41543518
539+a, c, tdbSNP:41553316
540+a, c, gdbSNP:41562518
541+c, tdbSNP:281860493
542+c, g, tdbSNP:41550715
544+c, g, tdbSNP:72558148
545+a, c, gdbSNP:281860494
complement(548)-g, cdbSNP:200892438
549+a, tdbSNP:45505091
complement(550..552)-, cggdbSNP:200155513
complement(550)-t, gdbSNP:77367175
550+a, c, g, tdbSNP:2308584
551+a, c, gdbSNP:2308585
553+a, c, tdbSNP:281860495
554+a, gdbSNP:281860496
555+a, c, g, tdbSNP:45578735
557+c, tdbSNP:41541313
558+a, c, tdbSNP:281860497
560+g, tdbSNP:281860498
561+a, gdbSNP:45622747
562+c, g, tdbSNP:45465598
563+a, c, g, tdbSNP:45597335
564+, adbSNP:281860499
complement(564)-t, adbSNP:1050367
complement(564)-t, adbSNP:142570222
565+, cdbSNP:281860500
565+c, tdbSNP:281860501
566+c, g, tdbSNP:11547350
complement(567)-t, gdbSNP:200392944
568+a, gdbSNP:281860502
569+a, c, g, tdbSNP:41557114
570+a, c, g, tdbSNP:281860503
complement(571)-g, c, adbSNP:75272234
572+c, gdbSNP:281860504
574+a, tdbSNP:281860505
575+c, gdbSNP:281860506
576+c, tdbSNP:281860507
577+a, g, tdbSNP:1050366
578+a, g, tdbSNP:281860508
complement(579..580)-, cdbSNP:202134505
579+a, gdbSNP:41550816
580+a, gdbSNP:281860509
583+c, tdbSNP:41540014
584+a, gdbSNP:281860510
585+a, c, gdbSNP:281860511
586+c, tdbSNP:61759942
587+c, gdbSNP:281860512
588+c, g, tdbSNP:41551019
589+a, c, gdbSNP:41543523
591+a, gdbSNP:41552817
592+a, c, g, tdbSNP:2308590
594+a, gdbSNP:41551016
595+c, tdbSNP:281860513
596+a, c, gdbSNP:41560918
597+c, gdbSNP:281860514
601+a, gdbSNP:281860515
602+a, gdbSNP:281860516
complement(603..604)-ag, cadbSNP:71533837
603+a, c, g, tdbSNP:697743
604+a, g, tdbSNP:79636386
605+a, c, g, tdbSNP:2308592
607+c, gdbSNP:281860517
complement(608)-t, cdbSNP:113350320
complement(609)-t, g, cdbSNP:141142418
611+c, g, tdbSNP:281860518
612+c, tdbSNP:281860519
614+a, c, tdbSNP:281860520
615+a, c, tdbSNP:41561720
616+g, tdbSNP:281860521
618+a, c, gdbSNP:281860522
619+a, tdbSNP:75032224
620+c, gdbSNP:281860523
621..629+, ggcacgtgcdbSNP:281860524
622+a, gdbSNP:281860525
623+a, c, tdbSNP:41553425
624+a, c, gdbSNP:1050685
625+a, c, tdbSNP:1050686
626+c, g, tdbSNP:41555814
627+g, tdbSNP:41562916
628+a, c, g, tdbSNP:41543517
629+a, c, gdbSNP:281860527
629+, cdbSNP:281860526
630..635+, gtggagdbSNP:281860528
631+a, tdbSNP:281860529
632+a, gdbSNP:281860530
633+c, gdbSNP:281860531
634+a, tdbSNP:281860532
complement(635)-g, cdbSNP:138584390
635+, gdbSNP:281860533
complement(636)-c, adbSNP:201707949
complement(637)-g, cdbSNP:150127748
638+g, tdbSNP:281860534
640+c, tdbSNP:281860535
641+c, tdbSNP:41563115
643+a, g, tdbSNP:61759943
644+c, gdbSNP:281860536
645+a, c, gdbSNP:2308598
647+a, gdbSNP:281860537
complement(648)-g, adbSNP:77935220
649+a, gdbSNP:281860538
650+a, cdbSNP:41550613
651+c, g, tdbSNP:281860539
652+c, g, tdbSNP:281860540
654+a, gdbSNP:1050357
655+a, cdbSNP:281860541
656+a, gdbSNP:281860542
659+a, c, g, tdbSNP:1131104
660+a, c, g, tdbSNP:41552417
662+c, gdbSNP:281860543
663+a, gdbSNP:41561213
664+a, gdbSNP:75912596
665+a, gdbSNP:281860544
666+a, c, gdbSNP:1131103
668+a, c, gdbSNP:17413678
670+a, c, tdbSNP:17413685
671+a, gdbSNP:281860545
672+c, gdbSNP:281860546
673+c, tdbSNP:55730145
675+c, gdbSNP:41555616
678+c, g, tdbSNP:41552115
679+a, c, gdbSNP:281860547
680+c, tdbSNP:281860548
complement(681)-t, g, c, adbSNP:17849598
complement(682..683)-t, gdbSNP:17417024
682+c, g, tdbSNP:281860549
683+a, g, tdbSNP:2308604
684+a, gdbSNP:41541114
686+dbSNP:
686+a, cdbSNP:41547620
688+a, c, gdbSNP:1131096
complement(694)-t, cdbSNP:148650077
701+c, tdbSNP:1131292
702+c, gdbSNP:281860550
713+c, tdbSNP:1050344
715+c, g, tdbSNP:1050343
716+c, tdbSNP:281860551
717+a, c, gdbSNP:1050716
723+c, gdbSNP:281860552
727+a, c, gdbSNP:281860553
733+c, tdbSNP:41545014
735+a, gdbSNP:281860554
complement(736)-g, adbSNP:200200386
742+, gdbSNP:281860555
743+a, gdbSNP:41559418
753+a, cdbSNP:74500356
759+c, tdbSNP:281860556
761+c, tdbSNP:281860557
762+c, tdbSNP:61759944
768+a, gdbSNP:41562012
769+c, g, tdbSNP:281860558
780+c, gdbSNP:281860559
792+c, tdbSNP:1050328
797+c, tdbSNP:281860560
800+c, g, tdbSNP:1050326
801+a, gdbSNP:281860561
803+a, gdbSNP:281860562
807+c, tdbSNP:281860563
809+a, gdbSNP:1050320
811+c, tdbSNP:281860564
812+c, tdbSNP:1050317
818+c, tdbSNP:281860565
821+c, tdbSNP:2308618
822+c, gdbSNP:41547622
831+a, gdbSNP:281860566
837+a, cdbSNP:41542217
complement(838)-c, adbSNP:185215782
839+a, gdbSNP:281860567
852+a, gdbSNP:281860568
856+c, tdbSNP:281860569
complement(859)-g, adbSNP:201434209
871+a, cdbSNP:79767529
879+a, gdbSNP:1050276
883+c, tdbSNP:78176797
894+a, c, gdbSNP:707908
complement(896)-t, cdbSNP:202162097
899+a, gdbSNP:41542914
complement(909)-t, gdbSNP:28636630
911+a, c, gdbSNP:72558149
918+a, gdbSNP:2308622
complement(920)-t, gdbSNP:17413436
920+c, g, tdbSNP:41540117
923+a, gdbSNP:281860570
926+c, tdbSNP:61759945
930+a, gdbSNP:281860571
933+c, tdbSNP:41541219
937+a, c, g, tdbSNP:1131015
938+a, gdbSNP:1131014
943+c, tdbSNP:281860572
complement(945)-t, cdbSNP:1143388
945+c, tdbSNP:41558713
complement(946)-t, gdbSNP:1143393
946+g, tdbSNP:41546713
950+c, tdbSNP:45481597
956+a, cdbSNP:2308628
959+c, gdbSNP:281860573
960+a, gdbSNP:41556321
complement(960)-g, adbSNP:3177853
961..1006+dbSNP:
961..1006+, agccatcttcccagcccaccatccccatcatgggcatcgttgctggdbSNP:281860578
complement(961)-t, cdbSNP:9264621
complement(961)-t, cdbSNP:76506992
962+g, tdbSNP:281860579
963+a, cdbSNP:281860580
964+a, cdbSNP:281860581
complement(965)-t, cdbSNP:34794906
complement(965)-g, adbSNP:1130992
966+g, tdbSNP:281860582
complement(975)-g, adbSNP:45485294
complement(977)-g, adbSNP:11757919
988+a, tdbSNP:1065600
990+a, g, tdbSNP:1050180
complement(998)-g, adbSNP:45486697
complement(999)-c, adbSNP:12209550
1002+g, tdbSNP:41545712
1006+, gdbSNP:281860583
complement(1006)-c, adbSNP:200704360
complement(1008..1009)-, ggacagctgdbSNP:148706212
complement(1009)-g, adbSNP:199559204
complement(1010)-t, cdbSNP:201152245
1021+c, tdbSNP:1050147
complement(1035)-t, gdbSNP:45443998
complement(1035)-t, cdbSNP:1050132
1037+a, tdbSNP:41556617
complement(1044)-t, cdbSNP:146911342
complement(1044)-g, adbSNP:1050121
1047+a, gdbSNP:1050118
1049+c, gdbSNP:41540512
1050+a, gdbSNP:1130947
1052+c, tdbSNP:1050106
1054+c, tdbSNP:1050105
1056+a, gdbSNP:1130935
1057+a, tdbSNP:41542414
1058+g, tdbSNP:2308650
1060+, tdbSNP:281860584
1061+a, gdbSNP:41540416
complement(1061)-g, adbSNP:1143550
complement(1062)-t, cdbSNP:1130920
1062+c, tdbSNP:41560617
1063+a, gdbSNP:1143551
complement(1064)-g, adbSNP:181100963
1099+dbSNP:
1099+a, gdbSNP:76294545
1108+c, tdbSNP:41559915
complement(1111)-g, adbSNP:139702282
1112+a, gdbSNP:281860588
complement(1114)-dbSNP:
complement(1114)-g, cdbSNP:35708511
1117+c, gdbSNP:61759946
1152+a, gdbSNP:1130838
1160+, adbSNP:41544716
complement(1197)-dbSNP:
complement(1197)-c, adbSNP:187426182
complement(1208)-t, adbSNP:183137172
1212+c, tdbSNP:1049853
complement(1213)-g, adbSNP:193100294
1250+a, gdbSNP:1049724
1258+a, gdbSNP:1049709
1259+c, tdbSNP:1065711
complement(1267..1268)-, cadbSNP:71695980
1267+c, tdbSNP:3176007
complement(1276)-g, adbSNP:41289069
complement(1285)-g, adbSNP:187712210
1291+a, gdbSNP:1049668
1299+g, tdbSNP:1049663
1304+c, gdbSNP:1049650
complement(1308..1309)-, gdbSNP:201629107
complement(1312)-g, adbSNP:116229144
complement(1345)-t, cdbSNP:1049579
complement(1359)-g, adbSNP:1092
complement(1368)-t, cdbSNP:1091
complement(1390)-t, cdbSNP:1094
complement(1396)-, cdbSNP:9279068
complement(1422)-c, adbSNP:1130592
complement(1425)-t, cdbSNP:3207555
complement(1426..1427)-t, cdbSNP:3207561
complement(1427)-, adbSNP:71744726
complement(1428)-g, cdbSNP:9264589
complement(1429)-, cdbSNP:67384697
complement(1432)-t, cdbSNP:1130586
complement(1433)-g, adbSNP:1130580
complement(1433)-g, adbSNP:3177775
complement(1444)-g, adbSNP:1130576
complement(1451)-, taagdbSNP:60637457
complement(1460)-c, adbSNP:1130559
complement(1465)-g, adbSNP:1130558
complement(1466)-t, adbSNP:1130554
complement(1469)-g, adbSNP:1130552
complement(1473)-t, g, cdbSNP:1071643
complement(1481)-, atdbSNP:71687584
complement(1490)-t, gdbSNP:1130538
complement(1509..1510)-, cdbSNP:34238273
complement(1511..1512)-, cdbSNP:9281298
complement(1511)-t, cdbSNP:116302614
complement(1512..1513)-g, cdbSNP:3189472
complement(1512)-t, cdbSNP:115906458
complement(1512)-gct, ctcdbSNP:71533833
complement(1513)-, gdbSNP:67157575
complement(1513)-g, cdbSNP:28420948
complement(1513)-g, cdbSNP:74616764
complement(1514)-g, cdbSNP:1130525
complement(1522)-t, cdbSNP:115510686
complement(1541)-g, adbSNP:114027487
complement(1542..1543)-g, adbSNP:11547334
complement(1545)-g, adbSNP:1049281
complement(1549)-c, adbSNP:182562544
complement(1578)-g, adbSNP:35075694
Gene SymbolHLA-C
Gene SynonymD6S204; HLA-JY3; HLC-C; PSORS1
Chromosome6
Locus Map6p21.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001243042 Homo sapiens major histocompatibility complex, class I, C (HLA-C), transcript variant 2, mRNA. Full Length $459.94
ORF Sequence $319.29
NM_002117 Homo sapiens major histocompatibility complex, class I, C (HLA-C), transcript variant 1, mRNA. Full Length $459.94
ORF Sequence $319.29
Title Influence of HLA-C expression level on HIV control .
Author Apps,R., Qi,Y., Carlson,J.M., Chen,H., Gao,X., Thomas,R., Yuki,Y., Del Prete,G.Q., Goulder,P., Brumme,Z.L., Brumme,C.J., John,M., Mallal,S., Nelson,G., Bosch,R., Heckerman,D., Stein,J.L., Soderberg,K.A., Moody,M.A., Denny,T.N., Zeng,X., Fang,J., Moffett,A., Lifson,J.D., Goedert,J.J., Buchbinder,S., Kirk,G.D., Fellay,J., McLaren,P., Deeks,S.G., Pereyra,F., Walker,B., Michael,N.L., Weintrob,A., Wolinsky,S., Liao,W. and Carrington,M.
Journal Science 340 (6128), 87-91 (2013)
Title Genetic association with ERAP1 in psoriasis is confined to disease onset after puberty and not dependent on HLA-C*06 .
Author Lysell,J., Padyukov,L., Kockum,I., Nikamo,P. and Stahle,M.
Journal J. Invest. Dermatol. 133 (2), 411-417 (2013)
Title Molecular architecture of the MHC I peptide-loading complex: one tapasin molecule is essential and sufficient for antigen processing .
Author Hulpke,S., Baldauf,C. and Tampe,R.
Journal FASEB J. 26 (12), 5071-5080 (2012)
Title Human leukocyte antigen-C and killer cell immunoglobulin-like receptor gene polymorphisms among patients with syphilis in a Chinese Han population .
Author Zhuang,Y.L., Ren,G.J., Tian,K.L., Li,X.Y., Zhu,Y.B., Liu,J.L., Si,G.L., Li,P., Zhang,Y., Wang,L., Zhang,W.J., Wang,D.J. and Zhu,C.F.
Journal APMIS 120 (10), 828-835 (2012)
Title HLA-C-dependent prevention of leukemia relapse by donor activating KIR2DS1 .
Author Venstrom,J.M., Pittari,G., Gooley,T.A., Chewning,J.H., Spellman,S., Haagenson,M., Gallagher,M.M., Malkki,M., Petersdorf,E., Dupont,B. and Hsu,K.C.
Journal N. Engl. J. Med. 367 (9), 805-816 (2012)
Title Distinctive polymorphism at the HLA-C locus: implications for the expression of HLA-C .
Author Zemmour,J. and Parham,P.
Journal J. Exp. Med. 176 (4), 937-950 (1992)
Title Unusual HLA-B alleles in two tribes of Brazilian Indians .
Author Belich,M.P., Madrigal,J.A., Hildebrand,W.H., Zemmour,J., Williams,R.C., Luz,R., Petzl-Erler,M.L. and Parham,P.
Journal Nature 357 (6376), 326-329 (1992)
Title The molecular basis for reactivity of anti-Cw1 and anti-Cw3 alloantisera with HLA-B46 haplotypes .
Author Zemmour,J., Gumperz,J.E., Hildebrand,W.H., Ward,F.E., Marsh,S.G., Williams,R.C. and Parham,P.
Journal Tissue Antigens 39 (5), 249-257 (1992)
Title Isolation and characterization of a genomic HLA-Cw6 clone .
Author Steinle,A., Nossner,E. and Schendel,D.J.
Journal Tissue Antigens 39 (3), 134-137 (1992)
Title Evolutionary relationship between immunoglobulins and transplantation antigens .
Author Peterson,P.A., Rask,L., Sege,K., Klareskog,L., Anundi,H. and Ostberg,L.
Journal Proc. Natl. Acad. Sci. U.S.A. 72 (4), 1612-1616 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878