• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens major histocompatibility complex, class II, DO beta (HLA-DOB), mRNA.


RefSeq Accession Definition Services Price Order
NM_002120 Homo sapiens major histocompatibility complex, class II, DO beta (HLA-DOB), mRNA. ORF Sequence $238.38
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002120.3, 118402587
Length 1388 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens major histocompatibility complex, class II, DO beta (HLA-DOB), mRNA.
Product HLA class II histocompatibility antigen, DO beta chain precursor
Comment

Summary: HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq, Jul 2008].

RefSeq NP_002111.1
CDS 98..919
Misc Feature(1)176..457
Misc Feature(2)212..436
Misc Feature(3)458..739
Misc Feature(4)464..745
Misc Feature(5)740..769
Misc Feature(6)770..832
Exon (1)1..188
Gene:HLA-DOB
Gene Synonym:DOB
Exon (2)189..458
Gene:HLA-DOB
Gene Synonym:DOB
Exon (3)459..740
Gene:HLA-DOB
Gene Synonym:DOB
Exon (4)741..851
Gene:HLA-DOB
Gene Synonym:DOB
Exon (5)852..883
Gene:HLA-DOB
Gene Synonym:DOB
Exon (6)884..1372
Gene:HLA-DOB
Gene Synonym:DOB
Translation MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRK VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWT FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(43)-dbSNP:
complement(43)-g, adbSNP:2071469
complement(73)-g, adbSNP:2071470
complement(150)-g, adbSNP:2071554
complement(151)-t, g, adbSNP:112887968
complement(181)-t, cdbSNP:2071471
complement(193)-dbSNP:
complement(193)-g, adbSNP:7383287
complement(194)-g, adbSNP:193195994
complement(229)-g, adbSNP:150439063
complement(244)-g, cdbSNP:201748352
complement(283)-t, cdbSNP:141308106
complement(290)-g, adbSNP:147835586
complement(291)-t, cdbSNP:144504518
complement(353)-t, gdbSNP:142229094
complement(382)-g, adbSNP:2239697
complement(405)-c, adbSNP:144814623
complement(421)-g, adbSNP:148406921
complement(424)-g, cdbSNP:144487320
complement(453)-t, cdbSNP:143319753
complement(482)-dbSNP:
complement(482)-g, adbSNP:201263357
complement(512)-t, gdbSNP:139684832
complement(559)-t, cdbSNP:202214628
complement(567)-c, adbSNP:146350950
complement(587)-g, cdbSNP:142148406
complement(624)-t, cdbSNP:201198783
complement(688)-t, cdbSNP:201306170
complement(688)-g, adbSNP:17501267
complement(689)-t, gdbSNP:113873432
complement(691)-g, adbSNP:150977248
complement(701)-t, cdbSNP:141132227
complement(725)-g, adbSNP:11575907
complement(795)-dbSNP:
complement(795)-g, adbSNP:201921473
complement(797)-t, cdbSNP:2070121
complement(798)-c, adbSNP:112802855
complement(811)-g, adbSNP:55816512
complement(819)-t, gdbSNP:2071478
complement(827)-g, adbSNP:2621330
complement(828)-g, adbSNP:111971502
complement(845)-g, adbSNP:113536280
complement(851)-t, cdbSNP:201484149
complement(873)-dbSNP:
complement(873)-g, cdbSNP:201637948
complement(879)-t, cdbSNP:143706496
complement(881)-t, cdbSNP:200490776
complement(930)-dbSNP:
complement(930)-, cdbSNP:55798049
complement(936..937)-, cdbSNP:56040300
complement(955)-t, cdbSNP:41258084
complement(964)-t, cdbSNP:201593955
complement(977)-, gdbSNP:56150445
complement(981)-g, cdbSNP:200674755
complement(998)-t, cdbSNP:2070120
complement(998)-g, adbSNP:201716828
complement(999)-t, cdbSNP:111466995
complement(1027..1028)-, agdbSNP:56225733
complement(1086)-g, adbSNP:187196646
complement(1188)-t, cdbSNP:11244
complement(1188)-t, cdbSNP:201493562
complement(1189)-t, g, cdbSNP:113166463
complement(1262)-t, cdbSNP:145480626
complement(1314..1315)-, gdbSNP:35340893
complement(1339..1340)-t, cdbSNP:11537545
complement(1340)-g, adbSNP:10364
Gene SymbolHLA-DOB
Gene SynonymDOB
Chromosome6
Locus Map6p21.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002120 Homo sapiens major histocompatibility complex, class II, DO beta (HLA-DOB), mRNA. Full Length $402.52
ORF Sequence $238.38
Title HLA-DO acts as a substrate mimic to inhibit HLA-DM by a competitive mechanism .
Author Guce,A.I., Mortimer,S.E., Yoon,T., Painter,C.A., Jiang,W., Mellins,E.D. and Stern,L.J.
Journal Nat. Struct. Mol. Biol. 20 (1), 90-98 (2013)
Title A genome-wide association study identifies three new risk loci for Kawasaki disease .
Author Onouchi,Y., Ozaki,K., Burns,J.C., Shimizu,C., Terai,M., Hamada,H., Honda,T., Suzuki,H., Suenaga,T., Takeuchi,T., Yoshikawa,N., Suzuki,Y., Yasukawa,K., Ebata,R., Higashi,K., Saji,T., Kemmotsu,Y., Takatsuki,S., Ouchi,K., Kishi,F., Yoshikawa,T., Nagai,T., Hamamoto,K., Sato,Y., Honda,A., Kobayashi,H., Sato,J., Shibuta,S., Miyawaki,M., Oishi,K., Yamaga,H., Aoyagi,N., Iwahashi,S., Miyashita,R., Murata,Y., Sasago,K., Takahashi,A., Kamatani,N., Kubo,M., Tsunoda,T., Hata,A., Nakamura,Y. and Tanaka,T.
Journal Nat. Genet. 44 (5), 517-521 (2012)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions .
Author Barcellos,L.F., May,S.L., Ramsay,P.P., Quach,H.L., Lane,J.A., Nititham,J., Noble,J.A., Taylor,K.E., Quach,D.L., Chung,S.A., Kelly,J.A., Moser,K.L., Behrens,T.W., Seldin,M.F., Thomson,G., Harley,J.B., Gaffney,P.M. and Criswell,L.A.
Journal PLoS Genet. 5 (10), E1000696 (2009)
Title Keeping the (kinase) party going: SLP-76 and ITK dance to the beat .
Author Qi,Q. and August,A.
Journal Sci. STKE 2007 (396), PE39 (2007)
Title The major histocompatibility complex-encoded proteasome component LMP7: alternative first exons and post-translational processing .
Author Glynne,R., Kerr,L.A., Mockridge,I., Beck,S., Kelly,A. and Trowsdale,J.
Journal Eur. J. Immunol. 23 (4), 860-866 (1993)
Title DNA sequence analysis of 66 kb of the human MHC class II region encoding a cluster of genes for antigen processing .
Author Beck,S., Kelly,A., Radley,E., Khurshid,F., Alderton,R.P. and Trowsdale,J.
Journal J. Mol. Biol. 228 (2), 433-441 (1992)
Title Human class II DNA and DOB genes display low sequence variability .
Author Jonsson,A.K. and Rask,L.
Journal Immunogenetics 29 (6), 411-413 (1989)
Title Class II genes of the human major histocompatibility complex. The .
Author Servenius,B., Rask,L. and Peterson,P.A.
Journal J. Biol. Chem. 262 (18), 8759-8766 (1987)
Title DO beta: a new beta chain gene in HLA-D with a distinct regulation of expression .
Author Tonnelle,C., DeMars,R. and Long,E.O.
Journal EMBO J. 4 (11), 2839-2847 (1985)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878