Homo sapiens major histocompatibility complex, class II, DO beta (HLA-DOB), mRNA.
| RefSeq Version | NM_002120.3, 118402587 |
| Length | 1388 bp |
| Structure | linear |
| Update Date | 12-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens major histocompatibility complex, class II, DO beta (HLA-DOB), mRNA. |
| Product | HLA class II histocompatibility antigen, DO beta chain precursor |
| Comment | Summary: HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq]. |
| RefSeq | NP_002111.1 |
| CDS | 98..919 | Exon (1) | 1..188 | Exon (2) | 1..188 | Exon (3) | 189..458 | Exon (4) | 459..740 | Exon (5) | 741..851 | Exon (6) | 852..883 | Exon (7) | 884..1372 |
| Translation | MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWT
FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 43 | + | a, g | dbSNP:2071469 |
| complement(43) | - | t, c | dbSNP:111612312 |
| 73 | + | a, g | dbSNP:2071470 |
| 150 | + | a, g | dbSNP:2071554 |
| complement(151) | - | t, g, a | dbSNP:112887968 |
| complement(181) | - | g, a | dbSNP:111815901 |
| 181 | + | c, t | dbSNP:2071471 |
| complement(193) | - | g, a | dbSNP:7383287 |
| 382 | + | a, g | dbSNP:2239697 |
| complement(688) | - | g, a | dbSNP:17501267 |
| complement(689) | - | t, g | dbSNP:113873432 |
| 725 | + | a, g | dbSNP:11575907 |
| 797 | + | c, t | dbSNP:2070121 |
| complement(798) | - | c, a | dbSNP:112802855 |
| complement(811) | - | g, a | dbSNP:55816512 |
| 819 | + | g, t | dbSNP:2071478 |
| 827 | + | a, g | dbSNP:2621330 |
| complement(828) | - | g, a | dbSNP:111971502 |
| complement(845) | - | g, a | dbSNP:113536280 |
| complement(930) | - | , c | dbSNP:55798049 |
| complement(936..937) | - | , c | dbSNP:56040300 |
| complement(955) | - | t, c | dbSNP:41258084 |
| complement(977) | - | , g | dbSNP:56150445 |
| 998 | + | c, t | dbSNP:2070120 |
| complement(999) | - | t, c | dbSNP:111466995 |
| complement(1019) | - | t, g | dbSNP:76328058 |
| complement(1027..1028) | - | , ag | dbSNP:56225733 |
| 1188 | + | c, t | dbSNP:11244 |
| complement(1189) | - | t, g, c | dbSNP:113166463 |
| complement(1314..1315) | - | , g | dbSNP:35340893 |
| complement(1339..1340) | - | t, c | dbSNP:11537545 |
| 1340 | + | a, g | dbSNP:10364 |
| Title | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score . |
| Author | Rose,J.E., Behm,F.M., Drgon,T., Johnson,C. and Uhl,G.R. |
| Journal | Mol. Med. 16 (7-8), 247-253 (2010) |
| Title | New genetic associations detected in a host response study to hepatitis B vaccine . |
| Author | Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M. |
| Journal | Genes Immun. 11 (3), 232-238 (2010) |
| Title | High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions . |
| Author | Barcellos,L.F., May,S.L., Ramsay,P.P., Quach,H.L., Lane,J.A., Nititham,J., Noble,J.A., Taylor,K.E., Quach,D.L., Chung,S.A., Kelly,J.A., Moser,K.L., Behrens,T.W., Seldin,M.F., Thomson,G., Harley,J.B., Gaffney,P.M. and Criswell,L.A. |
| Journal | PLoS Genet. 5 (10), E1000696 (2009) |
| Title | Keeping the (kinase) party going: SLP-76 and ITK dance to the beat . |
| Author | Qi,Q. and August,A. |
| Journal | Sci. STKE 2007 (396), PE39 (2007) |
| Title | A flexible array format for large-scale, rapid blood group DNA typing . |
| Author | Hashmi,G., Shariff,T., Seul,M., Vissavajjhala,P., Hue-Roye,K., Charles-Pierre,D., Lomas-Francis,C., Chaudhuri,A. and Reid,M.E. |
| Journal | Transfusion 45 (5), 680-688 (2005) |
| Title | The major histocompatibility complex-encoded proteasome component LMP7: alternative first exons and post-translational processing . |
| Author | Glynne,R., Kerr,L.A., Mockridge,I., Beck,S., Kelly,A. and Trowsdale,J. |
| Journal | Eur. J. Immunol. 23 (4), 860-866 (1993) |
| Title | DNA sequence analysis of 66 kb of the human MHC class II region encoding a cluster of genes for antigen processing . |
| Author | Beck,S., Kelly,A., Radley,E., Khurshid,F., Alderton,R.P. and Trowsdale,J. |
| Journal | J. Mol. Biol. 228 (2), 433-441 (1992) |
| Title | Human class II DNA and DOB genes display low sequence variability . |
| Author | Jonsson,A.K. and Rask,L. |
| Journal | Immunogenetics 29 (6), 411-413 (1989) |
| Title | Class II genes of the human major histocompatibility complex. The . |
| Author | Servenius,B., Rask,L. and Peterson,P.A. |
| Journal | J. Biol. Chem. 262 (18), 8759-8766 (1987) |
| Title | DO beta: a new beta chain gene in HLA-D with a distinct regulation of expression . |
| Author | Tonnelle,C., DeMars,R. and Long,E.O. |
| Journal | EMBO J. 4 (11), 2839-2847 (1985) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |