• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens major histocompatibility complex, class II, DP beta 1 (HLA-DPB1), mRNA.


RefSeq Accession Definition Services Price Order
NM_002121 Homo sapiens major histocompatibility complex, class II, DP beta 1 (HLA-DPB1), mRNA. ORF Sequence $225.33
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002121.5, 334688863
Length 4055 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens major histocompatibility complex, class II, DP beta 1 (HLA-DPB1), mRNA.
Product HLA class II histocompatibility antigen, DP beta 1 chain precursor
Comment

Summary: HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002112.3
CDS 117..893
Misc Feature(1)57..59
Misc Feature(2)57..59
Misc Feature(3)204..479
Misc Feature(4)243..455
Misc Feature(5)480..761
Misc Feature(6)486..767
Misc Feature(7)order(501..503,555..560,564..566,642..665)
Misc Feature(8)order(564..566,648..656,660..662)
Misc Feature(9)762..791
Misc Feature(10)792..854
Exon (1)1..216
Gene:HLA-DPB1
Gene Synonym:DPB1; HLA-DP; HLA-DP1B; HLA-DPB
Exon (2)217..480
Gene:HLA-DPB1
Gene Synonym:DPB1; HLA-DP; HLA-DP1B; HLA-DPB
Exon (3)481..762
Gene:HLA-DPB1
Gene Synonym:DPB1; HLA-DP; HLA-DP1B; HLA-DPB
Exon (4)763..873
Gene:HLA-DPB1
Gene Synonym:DPB1; HLA-DP; HLA-DP1B; HLA-DPB
Exon (5)874..897
Gene:HLA-DPB1
Gene Synonym:DPB1; HLA-DP; HLA-DP1B; HLA-DPB
Exon (6)898..4055
Gene:HLA-DPB1
Gene Synonym:DPB1; HLA-DP; HLA-DP1B; HLA-DPB
Translation MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYN REEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQR RVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW TFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC GVGIFMHRRSKKVQRGSA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
91+c, tdbSNP:144456909
102+c, tdbSNP:146638354
103+c, gdbSNP:149181738
140+a, gdbSNP:41540314
163+c, tdbSNP:41558014
167+a, gdbSNP:146214653
187+c, tdbSNP:11551416
197+c, tdbSNP:139072161
224+dbSNP:
224+a, cdbSNP:41544522
225+c, gdbSNP:1126504
226+c, tdbSNP:202176660
227+g, tdbSNP:1126506
228+c, g, tdbSNP:12722013
229+a, tdbSNP:1126509
231+c, tdbSNP:79389600
234+g, tdbSNP:1126511
235+g, tdbSNP:1126513
238+g, tdbSNP:41540313
251+c, tdbSNP:188627284
252+a, c, gdbSNP:41555313
285+g, tdbSNP:41553416
297+a, cdbSNP:41545716
298+c, gdbSNP:41561114
300+c, gdbSNP:12722018
302+a, gdbSNP:41555423
306+c, tdbSNP:9277348
307+a, tdbSNP:1042117
308+c, tdbSNP:41555415
310+c, tdbSNP:1042121
318+g, tdbSNP:77062860
330+g, tdbSNP:41552915
332+a, gdbSNP:12722022
337+a, tdbSNP:145190720
343+a, cdbSNP:147611944
349+c, gdbSNP:200784721
351+c, gdbSNP:200055547
352+a, tdbSNP:200572113
361+g, tdbSNP:201374258
367+a, c, tdbSNP:707958
368+c, g, tdbSNP:9277351
370+a, cdbSNP:1042131
371+a, c, gdbSNP:80330773
373+a, tdbSNP:41545212
374+c, gdbSNP:1042133
375+c, tdbSNP:114493737
381+a, cdbSNP:41550319
393+c, gdbSNP:41560812
396+a, c, tdbSNP:1042136
397+a, tdbSNP:41547212
399+c, tdbSNP:41547418
402+a, g, tdbSNP:41553216
405+c, gdbSNP:199865386
406+a, gdbSNP:201237929
408+a, c, g, tdbSNP:1042140
409+a, gdbSNP:12722027
411+c, tdbSNP:41554314
413+g, tdbSNP:41560217
417+g, tdbSNP:41546618
419+g, tdbSNP:41556420
421+c, tdbSNP:41551920
425+c, tdbSNP:61759928
428+a, gdbSNP:41545021
429+a, gdbSNP:1042151
430+c, tdbSNP:111596796
431+a, gdbSNP:1042153
453+a, gdbSNP:76968043
454+a, g, tdbSNP:1042169
456..457+, adbSNP:141530233
457+a, gdbSNP:9277354
459+c, gdbSNP:9277355
461+c, gdbSNP:1126532
462+, adbSNP:202162010
462+a, gdbSNP:9277356
470+a, gdbSNP:41542615
475+a, gdbSNP:41541915
476+c, tdbSNP:41563418
490+dbSNP:
490+a, gdbSNP:1126537
497+c, tdbSNP:1126541
517+a, gdbSNP:61736937
522+a, c, g, tdbSNP:1042187
547+a, gdbSNP:61736936
557+a, gdbSNP:1042212
571+a, gdbSNP:61736935
574+a, gdbSNP:140447065
590+c, gdbSNP:61736934
673+a, tdbSNP:61736938
702+c, gdbSNP:144181653
704+c, tdbSNP:1042331
712+c, tdbSNP:1042335
735+a, cdbSNP:14362
740+c, tdbSNP:1071597
752+c, tdbSNP:41559424
766+dbSNP:
766+c, tdbSNP:143091535
768+c, tdbSNP:148208390
783+c, tdbSNP:142745911
784+a, c, g, tdbSNP:9276
800+a, gdbSNP:137879953
811+a, gdbSNP:199834306
816+c, tdbSNP:11551421
847+a, c, tdbSNP:3097675
878+dbSNP:
878+a, gdbSNP:150818884
886+c, tdbSNP:201552902
892+, adbSNP:67523850
907+dbSNP:
907+c, gdbSNP:1126719
913+c, tdbSNP:1126723
924+a, tdbSNP:1042448
935+a, gdbSNP:9277522
937+a, cdbSNP:9277523
955+c, tdbSNP:1042467
960+a, gdbSNP:113779453
963+c, tdbSNP:1042488
968+c, tdbSNP:1042497
982+c, tdbSNP:1042502
986+a, gdbSNP:1042507
992+a, cdbSNP:1042508
995+g, tdbSNP:1042511
996+a, tdbSNP:1042516
1003+g, tdbSNP:113390552
1015+c, gdbSNP:3749985
1039+a, gdbSNP:1042544
1045+c, tdbSNP:114068468
1064+a, cdbSNP:11551420
1101+c, tdbSNP:1042644
1132+a, gdbSNP:931
1134+c, gdbSNP:928
1137+c, tdbSNP:186748908
1141+c, tdbSNP:112596157
1161+c, tdbSNP:935
1168+a, gdbSNP:932
1177+c, tdbSNP:933
1182..1186+, ttctcdbSNP:144401610
1182+, ttctcdbSNP:35277091
1201+a, gdbSNP:929
1238+a, cdbSNP:930
1241+a, gdbSNP:934
1257+c, gdbSNP:9277529
1258+a, cdbSNP:143935385
1265+a, gdbSNP:9277530
1269+a, gdbSNP:9277531
1293+g, tdbSNP:9277532
1303+c, tdbSNP:9277533
1389+a, gdbSNP:9277534
1409+a, gdbSNP:148631508
1443+a, gdbSNP:9277535
1457+c, gdbSNP:142130667
1467+a, tdbSNP:115991335
1472+c, tdbSNP:9277536
1506+g, tdbSNP:3097677
1591+a, cdbSNP:9277537
1629+a, gdbSNP:9277538
1661+a, gdbSNP:9277539
1680+c, tdbSNP:9501255
1694+a, gdbSNP:3097678
1705+a, gdbSNP:9277540
1740+a, gdbSNP:9277541
1768..1769+, tttdbSNP:67703005
1779+, cdbSNP:9280312
1779+c, tdbSNP:72500564
1829+c, tdbSNP:9277542
1862..1864+, ttcdbSNP:139610109
1864+, c, ctdbSNP:9280313
1870..1871+, cdbSNP:9280314
1870+c, tdbSNP:73740309
1876+a, gdbSNP:9277543
1890+c, tdbSNP:9277544
1892+c, tdbSNP:140259177
1905+c, tdbSNP:9277545
1928+g, tdbSNP:9277546
1937+a, gdbSNP:9501257
1942+a, gdbSNP:114394575
1949+a, cdbSNP:9277547
1972+c, tdbSNP:9277548
2001+a, gdbSNP:9277549
2022+a, gdbSNP:200599840
2053+c, gdbSNP:146520390
2069+c, tdbSNP:9277550
2076+g, tdbSNP:9277551
2081+a, tdbSNP:112119417
2083+c, tdbSNP:9277552
2098+c, tdbSNP:9277553
2120+c, tdbSNP:9277554
2133+a, gdbSNP:9501259
2187+a, gdbSNP:9277555
2247..2249+, tctdbSNP:148969528
2248..2250+, cttdbSNP:77767960
2248+, cttdbSNP:9280315
2250..2252+, cttdbSNP:72548081
2302..2303+, cdbSNP:112170964
2303..2304+, cdbSNP:60460211
2307+g, tdbSNP:192449683
2362+c, tdbSNP:3128963
2400+a, gdbSNP:3128964
2424..2427+, tttadbSNP:202073495
2426..2429+, tatcdbSNP:5875436
2427..2430+, atctdbSNP:58245331
2427..2428+, atctdbSNP:9280316
2427+a, gdbSNP:77339491
2481+a, gdbSNP:3128965
2502+a, gdbSNP:116508234
2528+a, gdbSNP:3128966
2598+c, gdbSNP:140975703
2651+c, tdbSNP:3117229
2678+c, tdbSNP:62407982
2679+a, g, tdbSNP:3128967
2702+g, tdbSNP:150147034
2710+c, tdbSNP:138605898
2728+a, gdbSNP:58649023
2740..2741+, acdbSNP:9280317
2789+c, tdbSNP:3130186
2835+a, tdbSNP:3128968
2838+c, gdbSNP:148951134
2956+a, gdbSNP:3128969
2966+a, gdbSNP:9461832
2978..2979+, gdbSNP:11440264
2979..2980+, gdbSNP:9282413
2987+c, tdbSNP:3130187
3017+a, cdbSNP:3117228
3148+c, tdbSNP:3091281
3232+c, tdbSNP:9501260
3267+c, tdbSNP:35717031
3276+c, tdbSNP:9277557
3293+c, tdbSNP:9277558
3313+c, tdbSNP:9277559
3320+c, gdbSNP:9277560
3331+c, tdbSNP:9277561
3344+c, tdbSNP:9277562
3345+a, gdbSNP:9277563
3346+a, gdbSNP:111656434
3347+c, tdbSNP:9277564
3348+a, c, tdbSNP:3117227
3370+a, gdbSNP:9296075
3372+a, gdbSNP:143732348
3422+c, tdbSNP:9296076
3479+c, tdbSNP:9277565
3498+g, tdbSNP:9277566
3521+a, gdbSNP:116233905
3544+c, tdbSNP:3097649
3572+c, tdbSNP:9501262
3576+c, gdbSNP:73743105
3595+a, cdbSNP:9277567
3608+c, gdbSNP:184799022
3636..3637+, ttdbSNP:66953188
3636+, ttdbSNP:72477282
3637+c, tdbSNP:9277568
3663+c, gdbSNP:35824566
3686+c, tdbSNP:73743106
3696+a, gdbSNP:112303369
3706+a, gdbSNP:116633358
3713+c, tdbSNP:73743107
3717+a, gdbSNP:138293641
3758+c, tdbSNP:3130188
3780+c, gdbSNP:3091282
3795+c, tdbSNP:3091283
3814+c, tdbSNP:3128970
3826+g, tdbSNP:3091284
3905+a, gdbSNP:181449363
3932+c, tdbSNP:9296077
3933+a, gdbSNP:9501263
3945+a, cdbSNP:9296078
4022+c, tdbSNP:3097650
Gene SymbolHLA-DPB1
Gene SynonymDPB1; HLA-DP; HLA-DP1B; HLA-DPB
Chromosome6
Locus Map6p21.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002121 Homo sapiens major histocompatibility complex, class II, DP beta 1 (HLA-DPB1), mRNA. Full Length $1419.25
ORF Sequence $225.33
Title Genome-wide association study of aspirin-exacerbated respiratory disease in a Korean population .
Author Park,B.L., Kim,T.H., Kim,J.H., Bae,J.S., Pasaje,C.F., Cheong,H.S., Kim,L.H., Park,J.S., Lee,H.S., Kim,M.S., Choi,I.S., Choi,B.W., Kim,M.K., Shin,S., Shin,H.D. and Park,C.S.
Journal Hum. Genet. 132 (3), 313-321 (2013)
Title Chronic beryllium disease, HLA-DPB1, and the DP peptide binding groove .
Author Silveira,L.J., McCanlies,E.C., Fingerlin,T.E., Van Dyke,M.V., Mroz,M.M., Strand,M., Fontenot,A.P., Bowerman,N., Dabelea,D.M., Schuler,C.R., Weston,A. and Maier,L.A.
Journal J. Immunol. 189 (8), 4014-4023 (2012)
Title HLA-DPB1*0201 is associated with susceptibility to atopic myelitis in Japanese .
Author Sato,S., Isobe,N., Yoshimura,S., Kanamori,Y., Masaki,K., Matsushita,T. and Kira,J.
Journal J. Neuroimmunol. 251 (1-2), 110-113 (2012)
Title HLA-DP genetic variation, proxies for early life immune modulation and childhood acute lymphoblastic leukemia risk .
Author Urayama,K.Y., Chokkalingam,A.P., Metayer,C., Ma,X., Selvin,S., Barcellos,L.F., Wiemels,J.L., Wiencke,J.K., Taylor,M., Brennan,P., Dahl,G.V., Moonsamy,P., Erlich,H.A., Trachtenberg,E. and Buffler,P.A.
Journal Blood 120 (15), 3039-3047 (2012)
Title Genome-wide association study confirming association of HLA-DP with protection against chronic hepatitis B and viral clearance in Japanese and Korean .
Author Nishida,N., Sawai,H., Matsuura,K., Sugiyama,M., Ahn,S.H., Park,J.Y., Hige,S., Kang,J.H., Suzuki,K., Kurosaki,M., Asahina,Y., Mochida,S., Watanabe,M., Tanaka,E., Honda,M., Kaneko,S., Orito,E., Itoh,Y., Mita,E., Tamori,A., Murawaki,Y., Hiasa,Y., Sakaida,I., Korenaga,M., Hino,K., Ide,T., Kawashima,M., Mawatari,Y., Sageshima,M., Ogasawara,Y., Koike,A., Izumi,N., Han,K.H., Tanaka,Y., Tokunaga,K. and Mizokami,M.
Journal PLoS ONE 7 (6), E39175 (2012)
Title HLA class II nucleotide sequences, 1992 .
Author Marsh,S.G. and Bodmer,J.G.
Journal Tissue Antigens 40 (5), 229-243 (1992)
Title A novel HLA-DPB1 sequence, DPB1*2301 .
Author Eiermann,T.H., Uhl,S., Fakler,J. and Goldmann,S.F.
Journal Tissue Antigens 40 (2), 108-110 (1992)
Title Family study on HLA-DPB1 polymorphism: linkage analysis with HLA-DR/DQ and two 'new' alleles .
Author Mitsunaga,S., Kuwata,S., Tokunaga,K., Uchikawa,C., Takahashi,K., Akaza,T., Mitomi,Y. and Juji,T.
Journal Hum. Immunol. 34 (3), 203-211 (1992)
Title A new HLA-DPB1 allele from a patient with systemic lupus erythematosus .
Author Korioth,F., Hartung,K., Deicher,H. and Frey,J.
Journal Tissue Antigens 39 (4), 216-219 (1992)
Title Positive correlation between oligonucleotide typing and T-cell recognition of HLA-DP molecules .
Author de Koster,H.S., Kenter,M.J., D'Amaro,J., Luiten,R.M., Schroeijers,W.E., Giphart,M.J. and Termijtelen,A.
Journal Immunogenetics 34 (1), 12-22 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878