• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens major histocompatibility complex, class II, DQ alpha 1 (HLA-DQA1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002122 Homo sapiens major histocompatibility complex, class II, DQ alpha 1 (HLA-DQA1), mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_002122.3, 52426772
Length 1542 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens major histocompatibility complex, class II, DQ alpha 1 (HLA-DQA1), mRNA.
Product HLA class II histocompatibility antigen, DQ alpha 1 chain
Comment

Summary: HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq, Jul 2008].

RefSeq NP_002113.2
CDS 54..821
Misc Feature(1)33..35
Misc Feature(2)138..383
Misc Feature(3)138..383
Misc Feature(4)387..668
Misc Feature(5)order(399..401,405..413,417..419,573..575,579..581)
Misc Feature(6)order(471..479,537..548,561..566,579..581)
Exon (1)1..135
Gene:HLA-DQA1
Gene Synonym:CD; CELIAC1; DQ-A1; GSE; HLA-DQA
Exon (2)136..384
Gene:HLA-DQA1
Gene Synonym:CD; CELIAC1; DQ-A1; GSE; HLA-DQA
Exon (3)385..666
Gene:HLA-DQA1
Gene Synonym:CD; CELIAC1; DQ-A1; GSE; HLA-DQA
Exon (4)667..841
Gene:HLA-DQA1
Gene Synonym:CD; CELIAC1; DQ-A1; GSE; HLA-DQA
Exon (5)842..1542
Gene:HLA-DQA1
Gene Synonym:CD; CELIAC1; DQ-A1; GSE; HLA-DQA
Translation MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYV DLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSK SPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFL PSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCALGLSVGLMGIVVGTVFII QGLRSVGASRHQGPL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
7+dbSNP:
7+a, gdbSNP:9272426
15+a, gdbSNP:3207966
22+a, gdbSNP:200004305
25+c, gdbSNP:3187964
34+a, gdbSNP:1047985
52+a, gdbSNP:28383345
75+a, cdbSNP:1047989
84+a, gdbSNP:1047992
89+c, tdbSNP:1047993
92+a, c, g, tdbSNP:1130034
101+c, tdbSNP:41551712
102+a, gdbSNP:12722039
106+c, tdbSNP:11545686
113+c, tdbSNP:1129735
114+c, tdbSNP:142553763
123+a, gdbSNP:41545012
127+a, gdbSNP:12722042
143+dbSNP:
143+c, tdbSNP:1129737
146+c, tdbSNP:1129738
154+a, gdbSNP:1129740
155+c, tdbSNP:3205916
161+a, gdbSNP:1129742
167+c, gdbSNP:1129744
175+c, tdbSNP:1071630
179+c, tdbSNP:1129753
184+c, tdbSNP:41549715
191+c, gdbSNP:1129759
196+a, tdbSNP:12722051
199+c, gdbSNP:1048023
214+c, tdbSNP:112029808
218+c, tdbSNP:1048027
222+c, gdbSNP:10093
230+c, tdbSNP:1129765
241+a, gdbSNP:1142323
244+c, tdbSNP:36219699
252+a, gdbSNP:41543221
256+c, tdbSNP:1142324
261+a, c, tdbSNP:1142326
262+a, gdbSNP:3207983
263+g, tdbSNP:3207984
265+g, tdbSNP:1142328
270+c, gdbSNP:12722061
271+a, tdbSNP:3208105
272+g, tdbSNP:9272697
273+a, c, tdbSNP:9272698
276+a, c, tdbSNP:3207985
277..278+, adbSNP:200303565
277+a, gdbSNP:28383449
278+a, cdbSNP:9272699
279+a, c, g, tdbSNP:1048052
280+a, gdbSNP:12722069
282+a, c, g, tdbSNP:3188043
285+a, gdbSNP:4193
288..289+, ggtdbSNP:9279909
288+a, gdbSNP:12722072
288+, gdbSNP:41556812
290+a, tdbSNP:12722074
290+a, tdbSNP:139915542
298+c, gdbSNP:41541412
302+a, gdbSNP:9272702
303+g, tdbSNP:1142331
304+g, tdbSNP:1142332
313+c, gdbSNP:1142333
320+c, gdbSNP:1142334
323+c, g, tdbSNP:1048491
326+c, gdbSNP:3188501
327+a, c, gdbSNP:1142335
328+c, tdbSNP:9272709
335+c, tdbSNP:1048087
345..346+, gdbSNP:9282026
346+g, tdbSNP:9279910
347+a, gdbSNP:36219014
348+, adbSNP:199556640
348+a, c, gdbSNP:1064944
357+c, tdbSNP:41542116
361+a, cdbSNP:1129808
371+c, tdbSNP:1142338
372+a, gdbSNP:142591955
382+a, cdbSNP:201351192
415+dbSNP:
415+c, tdbSNP:1048122
419+c, tdbSNP:1048124
425+a, gdbSNP:1048134
426+c, gdbSNP:41555012
442+c, tdbSNP:707952
449+c, tdbSNP:707951
491+a, cdbSNP:1048173
509+c, gdbSNP:707950
510+g, tdbSNP:41547417
535+c, tdbSNP:41545514
537+a, cdbSNP:41552014
538+g, tdbSNP:41544114
579+c, tdbSNP:41550317
585+a, gdbSNP:143096598
588+c, tdbSNP:707949
600+g, tdbSNP:41561312
601+a, cdbSNP:7990
605+g, tdbSNP:707963
610+g, tdbSNP:707962
638+a, cdbSNP:2308889
644+c, tdbSNP:2308890
645+a, c, gdbSNP:2308891
681+dbSNP:
681+a, gdbSNP:9272785
683+a, cdbSNP:3188543
703+a, gdbSNP:144882737
716+c, tdbSNP:1048372
717+c, tdbSNP:35087390
725+a, gdbSNP:1048381
741+a, gdbSNP:9260
744+g, tdbSNP:41545416
757+a, gdbSNP:144742185
758+c, gdbSNP:1048414
761+c, tdbSNP:1048419
767+c, gdbSNP:1048430
775+a, gdbSNP:9272793
809+a, gdbSNP:13379
815+a, cdbSNP:1130116
833+a, gdbSNP:3188642
836+a, g, tdbSNP:1130117
837+a, gdbSNP:28400568
842+c, gdbSNP:9272862
843+a, tdbSNP:9272863
844+c, gdbSNP:9272864
849+a, g, tdbSNP:9272865
850+a, cdbSNP:9272866
853+g, tdbSNP:9272867
855+a, tdbSNP:9272868
856+a, gdbSNP:9272869
858+a, gdbSNP:9272870
860+a, c, gdbSNP:9272871
862+a, gdbSNP:7708
863..864+, cdbSNP:9279929
864+a, gdbSNP:28371168
866+a, tdbSNP:9272872
867+a, gdbSNP:9272873
870+a, c, gdbSNP:8227
872+g, tdbSNP:9272876
873..874+, ctdbSNP:9282036
876+a, tdbSNP:9272877
878..879+, acdbSNP:9282037
882..883+, ctdbSNP:9282039
882+a, cdbSNP:7600
882+a, cdbSNP:112931520
885+g, tdbSNP:9272879
886+a, cdbSNP:9272880
887+c, tdbSNP:9272881
890+a, gdbSNP:9272882
893+a, cdbSNP:9272883
894+a, gdbSNP:1048643
895+g, tdbSNP:9272885
899..900+, adbSNP:9282040
899+c, tdbSNP:1048645
902+a, tdbSNP:9272887
903+g, tdbSNP:9272888
904+a, gdbSNP:9272889
906+a, cdbSNP:185268211
908+c, g, tdbSNP:1130126
909+a, tdbSNP:9272892
913+a, cdbSNP:9272893
916+a, cdbSNP:9272894
918+a, gdbSNP:9272895
919+c, tdbSNP:9272896
920+a, cdbSNP:9272897
921+a, cdbSNP:9272898
922+a, c, tdbSNP:9272899
923..924+, gdbSNP:9282041
932+c, gdbSNP:28371169
933+c, tdbSNP:9272900
934+a, tdbSNP:9272901
936+a, cdbSNP:9272902
937+c, tdbSNP:9272903
938+a, gdbSNP:7142
938+a, gdbSNP:77015062
942..943+, cdbSNP:9279931
944..945+, cdbSNP:9279932
949+c, g, tdbSNP:9272905
954+c, tdbSNP:1130139
957+c, tdbSNP:9272907
959+c, g, tdbSNP:1130142
961+g, tdbSNP:9272910
962..964+, ggadbSNP:201719977
962+c, g, tdbSNP:28371170
963+g, tdbSNP:28371171
964..965+, ttttttc, tttttttdbSNP:28383904
964+a, c, tdbSNP:28371172
970+a, gdbSNP:1130144
971+c, tdbSNP:1130145
973+g, tdbSNP:9272913
976+a, gdbSNP:9272914
981+c, tdbSNP:1130148
982+c, gdbSNP:1142414
992+c, tdbSNP:142004833
1000+c, tdbSNP:7143
1001+a, cdbSNP:191251309
1005+a, gdbSNP:9272917
1006+a, cdbSNP:9272918
1010+a, cdbSNP:1142422
1021+c, tdbSNP:1142429
1028..1029+, t, ttdbSNP:9279935
1028+, t, ttdbSNP:67619814
1035+c, tdbSNP:9272921
1041..1042+, ttctcdbSNP:9279936
1045+c, tdbSNP:1138372
1046+, adbSNP:71715462
1047+a, gdbSNP:3667
1048+a, gdbSNP:1130151
1059+a, tdbSNP:1130152
1060+a, cdbSNP:1130153
1062+, gdbSNP:141823983
1064+c, gdbSNP:1130155
1065+a, tdbSNP:1138373
1073+a, gdbSNP:1142447
1081+a, gdbSNP:1130156
1085+a, gdbSNP:1130158
1089+a, c, g, tdbSNP:9492
1107+a, cdbSNP:1130161
1110+c, gdbSNP:1130162
1116+a, tdbSNP:9272932
1125+a, tdbSNP:1048726
1134+c, tdbSNP:9272934
1142+c, tdbSNP:1065036
1147+a, tdbSNP:1064985
1152+a, tdbSNP:3208161
1153+a, cdbSNP:9272937
1154+a, tdbSNP:3208165
1167+c, tdbSNP:28376734
1169+c, tdbSNP:9272938
1181+a, gdbSNP:707947
1187+g, tdbSNP:192684527
1194+a, cdbSNP:9272940
1196+c, tdbSNP:9272941
1197+a, gdbSNP:3208169
1205+g, tdbSNP:9272943
1207+a, tdbSNP:36216730
1211+g, tdbSNP:707946
1212+g, tdbSNP:28538060
1213+a, c, g, tdbSNP:9272945
1214+c, g, tdbSNP:707945
1220+c, tdbSNP:9272948
1221+a, tdbSNP:707944
1230+g, tdbSNP:9272950
1234+a, gdbSNP:183747744
1235+c, tdbSNP:62404112
1238+a, cdbSNP:9272951
1240+c, tdbSNP:9272952
1241+a, c, gdbSNP:9272953
1248+a, cdbSNP:9272954
1258+a, tdbSNP:9272955
1260+g, tdbSNP:9272956
1265+a, gdbSNP:9272957
1283+a, cdbSNP:9272958
1289+c, gdbSNP:1064991
1294+a, gdbSNP:1064993
1308+c, tdbSNP:1064994
1310..1312+, tgtdbSNP:201571916
1312..1313+, caadbSNP:16376
1314+g, tdbSNP:140118665
1328+a, gdbSNP:36216571
1329+a, gdbSNP:1061172
1342+c, g, tdbSNP:9272962
1347+c, tdbSNP:1065043
1356+c, tdbSNP:1065044
1368+c, g, tdbSNP:1065045
1373+a, gdbSNP:1065047
1378+c, tdbSNP:1065048
1388+a, cdbSNP:1065049
1402+a, gdbSNP:9272969
1412+a, tdbSNP:45512899
1414+c, tdbSNP:9272970
1415+c, gdbSNP:9272971
1422+c, tdbSNP:9272972
1425+g, tdbSNP:9272973
1428+c, tdbSNP:9272974
1434+a, tdbSNP:9272975
1454+a, gdbSNP:9272976
1457+c, tdbSNP:9272977
1458+a, cdbSNP:9272978
1464+a, gdbSNP:9272979
1470+c, tdbSNP:9272980
1486+a, gdbSNP:9272981
1489+a, gdbSNP:9272982
1505+c, tdbSNP:9272983
1506+a, gdbSNP:9272984
1514+a, gdbSNP:9272985
1515+a, gdbSNP:9272986
1516+a, gdbSNP:9272987
1519+a, gdbSNP:9272988
1527+c, gdbSNP:115001138
1531+a, cdbSNP:9272989
1540+a, tdbSNP:9272990
Gene SymbolHLA-DQA1
Gene SynonymCD; CELIAC1; DQ-A1; GSE; HLA-DQA
Chromosome6
Locus Map6p21.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002122 Homo sapiens major histocompatibility complex, class II, DQ alpha 1 (HLA-DQA1), mRNA. On-demand $449.00 14
XM_003846467 PREDICTED: Homo sapiens major histocompatibility complex, class II, DQ alpha 1, transcript variant 1 (HLA-DQA1), mRNA. On-demand $449.00 14
XM_003846468 PREDICTED: Homo sapiens major histocompatibility complex, class II, DQ alpha 1, transcript variant 2 (HLA-DQA1), mRNA. On-demand $449.00 14
XM_003846469 PREDICTED: Homo sapiens major histocompatibility complex, class II, DQ alpha 1, transcript variant 3 (HLA-DQA1), mRNA. On-demand $449.00 14
XM_003846470 PREDICTED: Homo sapiens major histocompatibility complex, class II, DQ alpha 1, transcript variant 4 (HLA-DQA1), mRNA. On-demand $399.00 14
Title Development of a high resolution melting method for genotyping of risk HLA-DQA1 and PLA2R1 alleles and ethnic distribution of these risk alleles .
Author Cui,G., Zhang,L., Xu,Y., Cianflone,K., Ding,H. and Wang,D.W.
Journal Gene 514 (2), 125-130 (2013)
Title Common variants in the HLA-DRB1-HLA-DQA1 HLA class II region are associated with susceptibility to visceral leishmaniasis .
Author Fakiola,M., Strange,A., Cordell,H.J., Miller,E.N., Pirinen,M., Su,Z., Mishra,A., Mehrotra,S., Monteiro,G.R., Band,G., Bellenguez,C., Dronov,S., Edkins,S., Freeman,C., Giannoulatou,E., Gray,E., Hunt,S.E., Lacerda,H.G., Langford,C., Pearson,R., Pontes,N.N., Rai,M., Singh,S.P., Smith,L., Sousa,O., Vukcevic,D., Bramon,E., Brown,M.A., Casas,J.P., Corvin,A., Duncanson,A., Jankowski,J., Markus,H.S., Mathew,C.G., Palmer,C.N., Plomin,R., Rautanen,A., Sawcer,S.J., Trembath,R.C., Viswanathan,A.C., Wood,N.W., Wilson,M.E., Deloukas,P., Peltonen,L., Christiansen,F., Witt,C., Jeronimo,S.M., Sundar,S., Spencer,C.C., Blackwell,J.M. and Donnelly,P.
Journal Nat. Genet. 45 (2), 208-213 (2013)
Title Associations of HLA DR and DQ molecules with Lyme borreliosis in Latvian patients .
Author Kovalchuka,L., Eglite,J., Lucenko,I., Zalite,M., Viksna,L. and Krumina,A.
Journal BMC Res Notes 5, 438 (2012)
Title GWAS identifies novel susceptibility loci on 6p21.32 and 21q21.3 for hepatocellular carcinoma in chronic hepatitis B virus carriers .
Author Li,S., Qian,J., Yang,Y., Zhao,W., Dai,J., Bei,J.X., Foo,J.N., McLaren,P.J., Li,Z., Yang,J., Shen,F., Liu,L., Yang,J., Li,S., Pan,S., Wang,Y., Li,W., Zhai,X., Zhou,B., Shi,L., Chen,X., Chu,M., Yan,Y., Wang,J., Cheng,S., Shen,J., Jia,W., Liu,J., Yang,J., Wen,Z., Li,A., Zhang,Y., Zhang,G., Luo,X., Qin,H., Chen,M., Wang,H., Jin,L., Lin,D., Shen,H., He,L., de Bakker,P.I., Wang,H., Zeng,Y.X., Wu,M., Hu,Z., Shi,Y., Liu,J. and Zhou,W.
Journal PLoS Genet. 8 (7), E1002791 (2012)
Title Association between HLA-DQ genotypes and haplotypes vs Helicobacter pylori infection in an Indonesian population .
Author Zhao,Y., Wang,J., Tanaka,T., Hosono,A., Ando,R., Soeripto,S., Ediati Triningsih,F.X., Triono,T., Sumoharjo,S., Astuti,E.Y., Gunawan,S. and Tokudome,S.
Journal Asian Pac. J. Cancer Prev. 13 (4), 1247-1251 (2012)
Title HLA class II nucleotide sequences, 1992 .
Author Marsh,S.G. and Bodmer,J.G.
Journal Tissue Antigens 40 (5), 229-243 (1992)
Title Two divergent routes of evolution gave rise to the DRw13 haplotypes .
Author Lee,K.W., Johnson,A.H. and Hurley,C.K.
Journal J. Immunol. 145 (9), 3119-3125 (1990)
Title The A3 allele of the HLA-DQA1 locus is associated with susceptibility to type 1 diabetes in Japanese .
Author Todd,J.A., Fukui,Y., Kitagawa,T. and Sasazuki,T.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (3), 1094-1098 (1990)
Title Ancient roots for polymorphism at the HLA-DQ alpha locus in primates .
Author Gyllensten,U.B. and Erlich,H.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 86 (24), 9986-9990 (1989)
Title Molecular analysis of the HLA class II genes in two DRw6-related haplotypes, DRw13 DQw1 and DRw14 DQw3 .
Author Kao,H.T., Gregersen,P.K., Tang,J.C., Takahashi,T., Wang,C.Y. and Silver,J.
Journal J. Immunol. 142 (5), 1743-1747 (1989)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.