• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens major histocompatibility complex, class II, DQ beta 1 (HLA-DQB1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002123 Homo sapiens major histocompatibility complex, class II, DQ beta 1 (HLA-DQB1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_002123.4, 345461082
Length 1656 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens major histocompatibility complex, class II, DQ beta 1 (HLA-DQB1), transcript variant 1, mRNA.
Product HLA class II histocompatibility antigen, DQ beta 1 chain isoform 1 precursor
Comment

Summary: HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011].


Transcript Variant: This variant (1) is the predominant transcript and encodes isoform 1. This transcript represents the DQB1*06:02:01:01 allele of the HLA-DQB1 gene, as represented in the assembled chromosome 6 in the primary assembly of the reference genome.

RefSeq NP_002114.3
CDS 83..868
Misc Feature(1)215..433
Misc Feature(2)467..748
Misc Feature(3)order(482..484,536..541,545..547,623..646)
Misc Feature(4)order(545..547,629..637,641..643)
Exon (1)1..191
Gene:HLA-DQB1
Gene Synonym:CELIAC1; HLA-DQB; IDDM1
Exon (2)192..461
Gene:HLA-DQB1
Gene Synonym:CELIAC1; HLA-DQB; IDDM1
Exon (3)462..743
Gene:HLA-DQB1
Gene Synonym:CELIAC1; HLA-DQB; IDDM1
Exon (4)744..854
Gene:HLA-DQB1
Gene Synonym:CELIAC1; HLA-DQB; IDDM1
Exon (5)855..1640
Gene:HLA-DQB1
Gene Synonym:CELIAC1; HLA-DQB; IDDM1
Translation MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVFQFKGMCYFTNGTERVRLVT RYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFR GILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLI RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVL GLIFLGLGLIIRQRSQKGLLH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
20+dbSNP:
20+c, gdbSNP:3210146
complement(38)-t, cdbSNP:371168889
complement(41)-g, adbSNP:67147537
42+a, gdbSNP:1049070
complement(62..64)-, agcdbSNP:71789649
62+a, gdbSNP:1049053
73+c, tdbSNP:34236112
80+a, gdbSNP:1049055
complement(94)-t, cdbSNP:9274522
98+g, tdbSNP:1049056
112+c, tdbSNP:1049072
117+a, gdbSNP:1049057
126+a, c, tdbSNP:3189152
complement(127)-t, cdbSNP:369709024
128+c, gdbSNP:36222416
136+c, g, tdbSNP:1049058
complement(143)-t, cdbSNP:368832944
149+g, tdbSNP:3891176
complement(151)-t, cdbSNP:372512148
154+c, gdbSNP:1049059
161+a, g, tdbSNP:1049060
complement(164..165)-ag, gadbSNP:67851506
164+c, tdbSNP:1049061
165+a, c, tdbSNP:1049062
166+a, gdbSNP:1130373
167+c, gdbSNP:1130366
complement(169)-t, cdbSNP:200162904
185+c, tdbSNP:12722106
203+dbSNP:
203+c, tdbSNP:12722107
complement(204)-t, adbSNP:9274407
complement(205)-t, gdbSNP:111588946
211+a, tdbSNP:56173496
216+c, g, tdbSNP:1130375
218+a, cdbSNP:1130368
235+c, tdbSNP:3204373
complement(236)-t, cdbSNP:188170056
238+c, gdbSNP:72558170
241+a, c, gdbSNP:1049079
246+g, tdbSNP:41540813
248+a, gdbSNP:281862059
complement(252..253)-, cccdbSNP:368078700
253+g, tdbSNP:1140310
254+c, g, tdbSNP:12722115
255+a, g, tdbSNP:1049066
257+c, gdbSNP:41563539
259+a, gdbSNP:1049068
complement(261)-g, cdbSNP:9274405
263+a, tdbSNP:41553112
266+a, c, tdbSNP:1049069
269+a, gdbSNP:281862066
273+a, gdbSNP:281862067
277+c, tdbSNP:45496594
complement(278)-g, adbSNP:200200868
279+a, c, gdbSNP:75769070
complement(283)-t, cdbSNP:9274402
286+c, gdbSNP:281862069
complement(287)-t, g, adbSNP:1130370
288+a, tdbSNP:281874782
290+a, gdbSNP:45519640
291+c, tdbSNP:1063318
292+a, gdbSNP:1049082
294+a, gdbSNP:281862072
298+c, gdbSNP:281862073
311+g, tdbSNP:281862074
312+a, gdbSNP:1049083
314+g, tdbSNP:281862076
complement(315)-t, adbSNP:9274398
complement(318)-t, adbSNP:9274397
319+c, tdbSNP:1049073
322+c, gdbSNP:3210148
324+c, tdbSNP:41558214
325+a, gdbSNP:1049074
complement(330)-g, cdbSNP:200780973
331+c, gdbSNP:41561518
complement(332)-g, cdbSNP:199697520
complement(333)-t, g, adbSNP:9274395
336+a, tdbSNP:1140313
341+c, tdbSNP:281862084
342+a, c, g, tdbSNP:1130380
343+c, gdbSNP:41557617
345+c, tdbSNP:1130381
347+a, gdbSNP:41552812
348+a, c, g, tdbSNP:1071637
349+c, tdbSNP:1140314
356+a, tdbSNP:41562414
358+c, tdbSNP:41543717
364+c, g, tdbSNP:1130382
367+c, gdbSNP:41556215
complement(377)-t, cdbSNP:9274389
378+a, tdbSNP:41563814
385+a, gdbSNP:281862092
386+a, gdbSNP:1130386
387+a, gdbSNP:41563819
389+a, gdbSNP:1130390
complement(390)-t, gdbSNP:9274387
complement(391)-t, gdbSNP:9274386
394+a, gdbSNP:3204379
396+c, tdbSNP:281862099
397+a, gdbSNP:281862100
398+g, tdbSNP:1130385
399+a, cdbSNP:1130387
complement(399)-tc, gadbSNP:74195786
complement(401)-g, c, adbSNP:9274384
403+g, tdbSNP:281862104
404+c, gdbSNP:281862105
407+a, gdbSNP:281862106
408+c, gdbSNP:1130392
409+a, c, gdbSNP:1130389
410+g, tdbSNP:281862109
412+a, gdbSNP:1130391
415+c, tdbSNP:281862111
417+a, gdbSNP:281862112
418+a, gdbSNP:281862113
420+a, cdbSNP:281862114
423+a, gdbSNP:281862115
425+c, tdbSNP:281862116
428+c, gdbSNP:1140316
431+g, tdbSNP:1140317
complement(435)-t, g, cdbSNP:9274380
complement(437)-g, adbSNP:9274379
438+a, tdbSNP:17412833
443+a, gdbSNP:1140318
444+c, gdbSNP:1140319
447+c, tdbSNP:1140320
449+c, tdbSNP:1130397
455+a, cdbSNP:1140321
458+a, cdbSNP:1140322
complement(462)-dbSNP:
complement(462)-g, adbSNP:9274030
complement(463)-t, cdbSNP:9274029
complement(470)-t, adbSNP:9274028
471+c, tdbSNP:281864111
complement(473)-t, cdbSNP:9274027
complement(474)-g, adbSNP:9274026
complement(475)-g, cdbSNP:9274025
complement(480)-g, adbSNP:9274024
complement(483)-g, cdbSNP:9274023
complement(485)-g, adbSNP:9274022
complement(486)-g, cdbSNP:9274021
complement(487)-t, cdbSNP:9274020
complement(489..490)-, agcadbSNP:9282128
complement(492..493)-, adbSNP:9282127
complement(500)-c, adbSNP:9274019
complement(501)-g, adbSNP:9274018
complement(502)-g, adbSNP:9274017
complement(507)-t, adbSNP:9274016
complement(511)-g, cdbSNP:9274015
complement(515)-t, gdbSNP:9274014
complement(517)-g, cdbSNP:9274013
complement(518)-t, gdbSNP:9274012
complement(520)-g, cdbSNP:9274011
complement(521)-t, gdbSNP:9274010
complement(522)-t, adbSNP:9274009
complement(523)-t, cdbSNP:9274008
524+a, gdbSNP:1049100
complement(527)-g, adbSNP:9274007
complement(529)-g, cdbSNP:9274006
532+a, gdbSNP:1063321
complement(535)-c, adbSNP:9274005
complement(536)-t, adbSNP:9274004
complement(538)-t, cdbSNP:9274003
complement(541)-t, g, adbSNP:9274002
complement(543..544)-, gadbSNP:373732791
complement(545)-c, adbSNP:9274001
551+a, gdbSNP:1049107
complement(552..553)-, tdbSNP:374741054
552+c, gdbSNP:1063322
complement(553)-g, cdbSNP:9273999
complement(554)-g, cdbSNP:9273998
556+c, gdbSNP:41542812
559+c, gdbSNP:281864116
complement(562)-t, gdbSNP:9273997
complement(563)-t, c, adbSNP:9273996
complement(564)-c, adbSNP:9273995
complement(565)-g, cdbSNP:9273994
567+a, gdbSNP:41544112
complement(568)-c, adbSNP:9273993
complement(571)-c, adbSNP:9273992
complement(572)-c, adbSNP:9273991
complement(574)-g, adbSNP:9273990
575+c, tdbSNP:63626961
complement(576)-t, cdbSNP:9273989
complement(577)-g, cdbSNP:9273988
complement(578)-t, gdbSNP:9273987
complement(579)-t, gdbSNP:9273986
complement(580)-g, adbSNP:9273985
complement(581)-g, cdbSNP:9273984
complement(582..583)-at, gcdbSNP:386699586
582+a, c, gdbSNP:2647032
583+c, tdbSNP:1049086
complement(584)-g, c, adbSNP:9273981
complement(586)-c, adbSNP:9273980
complement(587)-c, adbSNP:9273979
complement(588)-t, cdbSNP:370212878
589+a, gdbSNP:41543118
complement(596..598)-agt, ggcdbSNP:386699585
596+a, gdbSNP:1063323
complement(597)-g, cdbSNP:9273978
598+c, tdbSNP:1049087
599+a, gdbSNP:281864122
complement(600)-t, cdbSNP:9273976
601+c, tdbSNP:281864123
602+c, gdbSNP:281864124
complement(608)-t, adbSNP:9273975
complement(611)-, tdbSNP:369947362
611+a, gdbSNP:281864125
complement(612)-g, adbSNP:9273974
complement(613)-g, adbSNP:9273973
complement(616)-t, gdbSNP:9273972
complement(617)-g, c, adbSNP:9273971
complement(618)-t, adbSNP:9273970
619+a, c, tdbSNP:1049088
complement(621)-g, adbSNP:9273968
complement(623)-t, cdbSNP:9273967
complement(625)-c, adbSNP:9273966
complement(626)-t, cdbSNP:9273965
628+c, tdbSNP:1049130
complement(630)-g, cdbSNP:9273964
complement(631..632)-, cdbSNP:9282125
complement(634)-t, gdbSNP:9273963
complement(635)-t, adbSNP:9273962
complement(636)-c, adbSNP:9273961
640+c, tdbSNP:1049133
complement(642)-g, adbSNP:9273958
complement(647..648)-, atdbSNP:9280010
complement(650)-g, cdbSNP:9273957
complement(653)-t, cdbSNP:375347079
complement(654)-t, adbSNP:9273956
complement(657)-g, adbSNP:9273955
complement(658..659)-, adbSNP:9282124
complement(661)-t, cdbSNP:9273954
complement(662)-g, cdbSNP:9273953
complement(664)-t, gdbSNP:9273952
complement(665)-t, g, cdbSNP:9273951
complement(668)-t, gdbSNP:9273950
complement(670)-t, adbSNP:9273949
complement(671..672)-, cdbSNP:9282123
complement(672)-g, adbSNP:9273948
complement(673)-g, cdbSNP:9273947
complement(674)-g, cdbSNP:9273946
complement(677..678)-, tdbSNP:9282122
678+a, c, g, tdbSNP:701564
680..682+, ggadbSNP:281864128
complement(680)-g, cdbSNP:9273943
complement(681)-t, g, cdbSNP:9273942
682+, adbSNP:41548921
684+a, cdbSNP:41559620
685+c, g, tdbSNP:1049092
686+a, gdbSNP:80255621
complement(689)-g, adbSNP:9273939
complement(691)-g, cdbSNP:9273938
complement(692..693)-, gtdbSNP:9282121
complement(695)-g, adbSNP:9273937
complement(696)-t, cdbSNP:9273936
complement(697)-g, adbSNP:9273935
complement(699..700)-, adbSNP:9282120
700+a, cdbSNP:281864130
complement(707)-g, adbSNP:9273934
complement(708)-t, cdbSNP:9273933
complement(709)-g, cdbSNP:9273932
complement(711)-g, cdbSNP:9273931
complement(712)-g, adbSNP:9273930
complement(713..714)-, cctdbSNP:9282119
complement(715)-g, cdbSNP:9273929
complement(716)-t, gdbSNP:9273928
complement(718)-t, gdbSNP:9273927
complement(719)-g, adbSNP:9273926
complement(720)-t, adbSNP:9273925
complement(723..724)-, adbSNP:9282118
723+a, c, g, tdbSNP:1130398
724+a, cdbSNP:281864131
complement(725)-g, adbSNP:9273923
complement(727)-g, adbSNP:9273922
complement(728)-t, cdbSNP:9273921
complement(730)-g, adbSNP:9273920
732+c, tdbSNP:1130399
complement(732)-g, adbSNP:386518032
complement(733)-g, adbSNP:398122512
complement(734)-t, cdbSNP:9273918
735+c, tdbSNP:281864132
complement(740)-g, adbSNP:9273917
complement(741)-g, cdbSNP:9273916
complement(742)-g, cdbSNP:9273915
743+c, tdbSNP:63267060
complement(744)-dbSNP:
complement(744)-t, cdbSNP:9273667
complement(746)-g, cdbSNP:9273666
complement(747)-t, gdbSNP:9273665
complement(748)-t, adbSNP:9273664
complement(749)-g, cdbSNP:9273663
complement(751)-t, c, adbSNP:9273660
complement(752)-c, adbSNP:398122511
complement(757..758)-, atdbSNP:374985918
complement(759)-g, cdbSNP:9273659
complement(763)-g, cdbSNP:9273658
complement(766)-c, adbSNP:9273657
complement(767)-t, adbSNP:9273656
768+a, gdbSNP:1130429
complement(769)-g, cdbSNP:398122483
complement(771)-t, cdbSNP:9273654
complement(773)-t, gdbSNP:9273653
complement(775)-c, adbSNP:9273652
complement(779)-t, c, adbSNP:9273651
complement(780..781)-, gdbSNP:9282094
complement(784)-g, c, adbSNP:9273650
785+a, c, g, tdbSNP:1049163
complement(788..789)-, tdbSNP:9282093
complement(789)-c, adbSNP:9273647
complement(790)-t, gdbSNP:9273646
complement(791)-c, adbSNP:9273645
complement(792)-c, adbSNP:9273644
complement(794)-g, adbSNP:9273643
complement(798)-c, adbSNP:9273642
complement(805)-g, cdbSNP:9273641
808+c, g, tdbSNP:1130410
complement(811)-g, adbSNP:9273639
complement(812)-t, adbSNP:9273638
complement(816)-t, adbSNP:9273637
817+c, tdbSNP:1130430
complement(819)-g, cdbSNP:9273635
complement(820)-t, cdbSNP:9273634
823+a, g, tdbSNP:1130431
complement(826)-t, gdbSNP:9273632
complement(827)-g, cdbSNP:9273631
complement(829)-g, adbSNP:9273630
832+c, g, tdbSNP:3210168
complement(834)-t, adbSNP:9273628
complement(835)-t, gdbSNP:9273627
complement(836)-g, cdbSNP:9273626
837+a, gdbSNP:1140342
841+a, c, gdbSNP:1140343
complement(845)-t, cdbSNP:201457654
complement(846)-t, cdbSNP:9273622
complement(847)-g, adbSNP:9273621
849+a, c, gdbSNP:1130432
complement(850)-g, cdbSNP:398122510
complement(853)-t, cdbSNP:9273618
859+dbSNP:
859+c, tdbSNP:1140347
complement(879)-g, adbSNP:139850766
880+a, gdbSNP:1049175
889+a, g, tdbSNP:1063343
890+a, gdbSNP:1049177
893+c, tdbSNP:1049178
complement(902)-t, gdbSNP:201738242
905+a, c, g, tdbSNP:1063345
912+a, gdbSNP:3204428
914+c, tdbSNP:1063346
complement(923..925)-cat, gacdbSNP:386699569
923+a, gdbSNP:7656
925+c, g, tdbSNP:1063347
943+a, gdbSNP:36205178
complement(947)-g, adbSNP:9273463
complement(958..975)-ctgatctcgggggacag, ttgatctcagggggacaadbSNP:386699568
958+c, tdbSNP:1063348
959+g, tdbSNP:35888564
967+, tdbSNP:3842708
975+a, gdbSNP:1063349
complement(996)-t, cdbSNP:113664950
999+a, gdbSNP:1071639
1029+c, tdbSNP:1130420
complement(1030)-g, c, adbSNP:9273459
1031+a, gdbSNP:3210176
complement(1034..1035)-, adbSNP:66772188
complement(1035..1036)-, c, adbSNP:9282076
1036+g, tdbSNP:281864465
complement(1048)-g, adbSNP:1770
complement(1051)-t, cdbSNP:9273455
complement(1061)-g, cdbSNP:181293540
complement(1063)-c, adbSNP:115749644
complement(1069)-g, cdbSNP:9273453
1074+a, c, tdbSNP:1049122
1083+a, gdbSNP:1071641
complement(1086)-g, adbSNP:1766
1087+a, gdbSNP:1049123
complement(1096)-g, adbSNP:1764
complement(1097)-t, cdbSNP:78372297
complement(1104)-g, cdbSNP:79471319
1108+c, tdbSNP:1049213
1118+a, tdbSNP:1049219
complement(1123)-t, cdbSNP:183950119
1129+a, gdbSNP:1049222
1134+c, tdbSNP:1049225
1167+a, cdbSNP:1063355
complement(1167)-c, adbSNP:386514629
1168+c, tdbSNP:1049124
1181+c, tdbSNP:6689
1213+g, tdbSNP:3204433
1215+a, gdbSNP:3210187
1218..1255+a, gdbSNP:3204434
1219..1229+a, gdbSNP:3204435
complement(1227)-g, adbSNP:117067420
complement(1229)-g, cdbSNP:78434421
complement(1235)-g, adbSNP:9273445
1238+g, tdbSNP:1140365
complement(1246)-t, gdbSNP:9273444
complement(1254)-t, cdbSNP:34153824
1261+a, gdbSNP:1130445
1264+a, gdbSNP:1130446
1268+a, gdbSNP:36205798
complement(1278)-g, adbSNP:117789582
complement(1281)-t, gdbSNP:9273443
complement(1299)-t, gdbSNP:9273442
complement(1308)-g, cdbSNP:9273441
complement(1320)-t, cdbSNP:9273440
complement(1346)-t, gdbSNP:28724234
complement(1346)-, gdbSNP:62998560
complement(1347)-t, adbSNP:9273439
1354+g, tdbSNP:1130451
complement(1358)-g, adbSNP:9273438
complement(1359)-t, g, cdbSNP:9273437
complement(1364)-t, gdbSNP:9273436
1366+g, tdbSNP:1056315
1387+a, gdbSNP:1056316
complement(1388..1389)-, gdbSNP:63031662
complement(1389..1390)-, gdbSNP:9282075
complement(1390)-t, gdbSNP:112615708
complement(1392)-g, adbSNP:9273433
complement(1396)-t, cdbSNP:9273432
1401+c, tdbSNP:1064173
complement(1421)-t, gdbSNP:9273430
complement(1425)-g, adbSNP:9273429
1431+c, tdbSNP:1056318
complement(1435)-t, cdbSNP:28724233
complement(1440)-c, adbSNP:9273427
complement(1447)-c, adbSNP:9273426
1476+c, gdbSNP:1130455
complement(1485)-t, cdbSNP:9273425
complement(1487)-t, cdbSNP:9273424
complement(1491)-t, cdbSNP:9273423
complement(1495)-t, cdbSNP:12918
1502+a, gdbSNP:1130456
1514+a, gdbSNP:1130457
complement(1516)-t, cdbSNP:9273419
complement(1519)-c, adbSNP:9273418
complement(1529)-g, adbSNP:9273417
complement(1549)-, tdbSNP:376622401
complement(1551)-, tdbSNP:34835883
complement(1560)-t, gdbSNP:9273416
complement(1571)-t, cdbSNP:9273415
complement(1582)-t, adbSNP:9273414
complement(1589)-g, adbSNP:9273413
complement(1618)-t, cdbSNP:9273412
1618+a, gdbSNP:34243613
complement(1621)-g, adbSNP:9273411
complement(1631)-c, adbSNP:9273410
complement(1639)-t, cdbSNP:111951747
Gene SymbolHLA-DQB1
Gene SynonymCELIAC1; HLA-DQB; IDDM1
Chromosome6
Locus Map6p21.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001243961 Homo sapiens major histocompatibility complex, class II, DQ beta 1 (HLA-DQB1), transcript variant 2, mRNA. On-demand $449.00 14
NM_002123 Homo sapiens major histocompatibility complex, class II, DQ beta 1 (HLA-DQB1), transcript variant 1, mRNA. On-demand $449.00 14
NM_001243962 Homo sapiens major histocompatibility complex, class II, DQ beta 1 (HLA-DQB1), transcript variant 3, mRNA. In-stock $348.00 $299.00 10
Title HLA-DR, DQ class II DNA typing in pediatric panuveitis and tubulointerstitial nephritis and uveitis .
Author Reddy AK, Hwang YS, Mandelcorn ED and Davis JL.
Journal Am. J. Ophthalmol. 157 (3), 678-686 (2014)
Title The HLA class II allele DQB1 0309 is associated with dilated cardiomyopathy .
Author Pankuweit S, Ruppert V, Jonsdottir T, Muller HH and Meyer T.
Journal Gene 531 (2), 180-183 (2013)
Title Genome wide analysis of narcolepsy in China implicates novel immune loci and reveals changes in association prior to versus after the 2009 H1N1 influenza pandemic .
Author Han F, Faraco J, Dong XS, Ollila HM, Lin L, Li J, An P, Wang S, Jiang KW, Gao ZC, Zhao L, Yan H, Liu YN, Li QH, Zhang XZ, Hu Y, Wang JY, Lu YH, Lu CJ, Zhou W, Hallmayer J, Huang YS, Strohl KP, Pollmacher T and Mignot E.
Journal PLoS Genet. 9 (10), E1003880 (2013)
Title Association of HLA-DQB1*0501 with scleroderma and its clinical features in Chinese population .
Author Zhou XD, Yi L, Guo XJ, Chen E, Zou HJ, Jin L, Mayes MD, Assassi S and Wang JC.
Journal Int J Immunopathol Pharmacol 26 (3), 747-751 (2013)
Title Novel association analysis between HLA-DQB1 polymorphisms and rectal cancer based on a cross-validation design .
Author Tong FZ, Yu WJ and Liu H.
Journal Genet. Mol. Res. 12 (4), 5958-5963 (2013)
Title Celiac Disease .
Author Snyder,C.L., Young,D.O., Green,P.H.R. and Taylor,A.K.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Report on the sequence of DQB1*0301 gene in ocular cicatricial pemphigoid patients .
Author Haider N, Neuman R, Foster CS and Ahmed AR.
Journal Curr. Eye Res. 11 (12), 1233-1238 (1992)
Title Molecular analysis of novel HLA-DR2.DQwl haplotypes in Asian Indians .
Author Singal DP, Qiu X and Sood SK.
Journal Tissue Antigens 40 (2), 104-107 (1992)
Title A rare HLA DQB allele sequenced from patients with systemic lupus erythematosus .
Author Fronek Z, Timmerman LA and McDevitt HO.
Journal Hum. Immunol. 30 (2), 77-84 (1991)
Title Rapid typing of HLA-DQB1 DNA polymorphism using nonradioactive oligonucleotide probes and amplified DNA .
Author Bugawan TL and Erlich HA.
Journal Immunogenetics 33 (3), 163-170 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.