• THAT   AND
  • THAT   AND


Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002124 Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), mRNA. Full Lenth $356.41
ORF Sequence $232.29


RefSeq Version NM_002124.2, 155030210
Length 1229 bp
Structure linear
Update Date 05-MAY-2011
Organism Homo sapiens (human)
Definition Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), mRNA.
Product major histocompatibility complex, class II, DR beta 1 precursor
Comment

Summary: HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa. It is encoded by 6 exons. Exon one encodes the leader peptide; exons 2 and 3 encode the two extracellular domains; exon 4 encodes the transmembrane domain; and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Hundreds of DRB1 alleles have been described and typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogs DRB3, DRB4 and DRB5. DRB1 is present in all individuals. Allelic variants of DRB1 are linked with either none or one of the genes DRB3, DRB4 and DRB5. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. [provided by RefSeq].

RefSeq NP_002115.2
CDS 44..844
Exon (1)1..143
Exon (2)1..143
Exon (3)144..413
Exon (4)414..695
Exon (5)696..806
Exon (6)807..830
Exon (7)831..1166
Translation MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYF YNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTV QRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL FLGAGLFIYFRNQKGHSGLQPTGFLS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(3)-g, adbSNP:28366221
3+c, tdbSNP:1059544
4+a, gdbSNP:1059545
complement(4)-t, cdbSNP:28366220
11+c, tdbSNP:1059546
complement(12)-g, adbSNP:71549221
complement(14)-g, cdbSNP:17204744
complement(17)-t, cdbSNP:17204737
complement(20)-t, gdbSNP:17211078
complement(27)-g, adbSNP:17211071
complement(34)-g, cdbSNP:17211064
34+c, gdbSNP:1059547
57+a, gdbSNP:707953
complement(57)-t, cdbSNP:9270305
complement(57)-t, cdbSNP:80165193
59+c, tdbSNP:17879020
complement(66)-t, cdbSNP:111934004
70+c, tdbSNP:1059549
75+a, gdbSNP:1059551
complement(76)-g, adbSNP:34396110
complement(77)-t, adbSNP:116331390
complement(80)-t, cdbSNP:9270303
80+a, gdbSNP:78246137
83+a, gdbSNP:17878475
complement(84)-c, adbSNP:9270302
complement(85)-c, adbSNP:9270301
complement(98)-g, adbSNP:34187469
complement(102)-g, adbSNP:35053532
complement(128)-c, adbSNP:9270299
complement(140)-t, gdbSNP:9256943
141+a, gdbSNP:17879746
146+c, gdbSNP:41308497
complement(152)-g, adbSNP:9269960
complement(155)-t, c, adbSNP:9269959
complement(156)-t, cdbSNP:9269958
complement(158)-g, c, adbSNP:9269957
159+a, tdbSNP:17882663
complement(160)-g, cdbSNP:9269956
complement(161)-t, g, c, adbSNP:9269955
162+a, c, g, tdbSNP:17878703
165+a, cdbSNP:3179213
166+a, gdbSNP:17887028
167+g, tdbSNP:1136758
168+c, gdbSNP:1136759
complement(169)-c, adbSNP:9269951
170+a, gdbSNP:17882014
172+a, gdbSNP:17885011
176+c, tdbSNP:17879702
178+a, tdbSNP:17879981
complement(182)-g, adbSNP:114435757
184+c, tdbSNP:45600431
187+c, tdbSNP:17886488
187+c, tdbSNP:1136763
188+c, gdbSNP:61759931
189+c, gdbSNP:17879469
191+a, tdbSNP:61759932
192+a, cdbSNP:61759933
193+c, gdbSNP:17881146
197+a, c, gdbSNP:74812266
198+c, gdbSNP:17882378
complement(199..204)-, cgcaccdbSNP:66939620
204+a, g, tdbSNP:17885382
204+a, gdbSNP:1136625
205+g, tdbSNP:74481206
207+a, tdbSNP:16822516
208+a, c, g, tdbSNP:17884840
208+c, gdbSNP:1059572
complement(210..211)-, cadbSNP:67244437
210+a, c, g, tdbSNP:17878671
212+c, gdbSNP:17878947
214+a, c, gdbSNP:1059575
217+a, tdbSNP:17878437
complement(218)-g, adbSNP:113465897
218+, c, g, tdbSNP:11554462
219+a, g, tdbSNP:3175105
219+, a, g, tdbSNP:17882777
220+c, tdbSNP:17884729
221+a, g, tdbSNP:17882300
221+a, tdbSNP:1059346
224+c, g, tdbSNP:1064664
227+a, cdbSNP:17879995
229+a, c, tdbSNP:17879242
231+a, gdbSNP:17879476
232+a, gdbSNP:17882603
232+a, gdbSNP:1059348
234+a, gdbSNP:55655909
235+a, gdbSNP:17885071
238+a, gdbSNP:17882641
239+a, c, g, tdbSNP:16822820
240+a, c, tdbSNP:17883134
241+c, tdbSNP:72558164
242+c, g, tdbSNP:17878614
243+c, tdbSNP:17878951
246+a, gdbSNP:17886928
247+c, gdbSNP:17885772
249+a, tdbSNP:17882455
251+a, gdbSNP:56158521
complement(255)-c, adbSNP:11550037
259+c, tdbSNP:75044270
262+a, gdbSNP:72558165
263+a, c, gdbSNP:17885437
268+c, gdbSNP:17882006
269+c, tdbSNP:29029548
270+a, tdbSNP:17884945
271+c, tdbSNP:17879688
272+a, c, tdbSNP:17879937
273+a, g, tdbSNP:17886436
274+a, gdbSNP:55917654
276+a, c, tdbSNP:17879432
277+a, gdbSNP:35499948
278+g, tdbSNP:17885257
279+c, tdbSNP:17885908
282+c, g, tdbSNP:17884787
282+c, gdbSNP:1059582
283+g, tdbSNP:17880973
284+a, g, tdbSNP:17883065
287+a, cdbSNP:72558166
289+a, gdbSNP:17878622
289+a, gdbSNP:1059349
293+c, tdbSNP:17878902
294+g, tdbSNP:41308498
296+c, gdbSNP:17887012
298+c, tdbSNP:72558167
299+a, gdbSNP:17880292
300+a, c, g, tdbSNP:17885129
complement(301)-g, adbSNP:17853228
302+a, c, gdbSNP:1059583
303+a, c, g, tdbSNP:1059584
complement(304)-g, adbSNP:17853229
305+c, gdbSNP:17879954
306+a, gdbSNP:17879230
307+a, c, gdbSNP:17886514
308+a, c, tdbSNP:17882583
309+a, cdbSNP:1059586
318+a, gdbSNP:41508449
321+a, gdbSNP:17882098
322+, gdbSNP:17885020
323+, adbSNP:17883087
324+, adbSNP:17878577
326+a, gdbSNP:17878874
329+a, c, tdbSNP:17886918
332+c, tdbSNP:17881176
333+g, tdbSNP:41308499
complement(334..335)-, tdbSNP:71827189
complement(336..337)-, tdbSNP:71689970
336+a, gdbSNP:17882450
complement(337..338)-, tcdbSNP:28986201
337+a, gdbSNP:17885388
338+c, gdbSNP:17881965
complement(339..340)-, ttdbSNP:66585153
339+a, gdbSNP:17884070
340+c, gdbSNP:17879599
340+c, gdbSNP:1064591
341+a, g, tdbSNP:1064592
complement(342)-t, g, cdbSNP:9269942
342+a, c, gdbSNP:16822853
complement(342)-, gcdbSNP:71783033
complement(343..344)-, gdbSNP:28993507
343+a, gdbSNP:17880366
complement(344..345)-, cdbSNP:9281873
344+c, g, tdbSNP:17885222
complement(344)-, gdbSNP:67798196
complement(345..346)-, ccdbSNP:67187877
345+a, c, g, tdbSNP:17885869
346+c, g, tdbSNP:17884749
347+, g, tdbSNP:17883297
348+c, gdbSNP:17878857
348+c, gdbSNP:1059596
349+a, c, g, tdbSNP:3208330
350+, a, c, gdbSNP:16822805
351+a, c, g, tdbSNP:17886882
complement(351)-, gdbSNP:67476479
352+c, gdbSNP:17880261
356+a, gdbSNP:61759934
359+a, gdbSNP:17885079
complement(360)-t, gdbSNP:9269941
361+c, tdbSNP:16822512
362+c, g, tdbSNP:17884043
363+a, tdbSNP:17879620
364+c, g, tdbSNP:11554463
371+c, tdbSNP:29029549
379+c, tdbSNP:45542832
380+a, c, gdbSNP:17879213
382+a, gdbSNP:17885752
384+c, tdbSNP:17424145
386+a, gdbSNP:61759935
387+a, g, tdbSNP:17885482
388+g, tdbSNP:17882028
394+a, cdbSNP:17883271
400+a, gdbSNP:17878803
400+a, gdbSNP:1136782
403+c, gdbSNP:45594032
407+a, cdbSNP:17879125
409+a, gdbSNP:17878311
413+a, gdbSNP:17885959
418+a, g, tdbSNP:1071752
complement(418)-t, adbSNP:113609047
420+g, tdbSNP:79706935
421+c, tdbSNP:62799161
422+c, g, tdbSNP:17405219
complement(424)-t, gdbSNP:17424180
426+c, gdbSNP:80190494
427+c, tdbSNP:74944677
428+a, c, gdbSNP:1136791
429+a, gdbSNP:76895951
430+a, gdbSNP:62889561
complement(433)-t, cdbSNP:111823233
439+a, gdbSNP:17405226
440+g, tdbSNP:1136795
complement(441..442)-, tdbSNP:35616319
complement(441)-g, adbSNP:117994013
complement(442)-t, gdbSNP:115205732
complement(443..444)-, tdbSNP:66896735
complement(446..447)-, gdbSNP:34749207
446+g, tdbSNP:17433947
448+c, gdbSNP:17401330
complement(449)-, gdbSNP:67245200
454+c, tdbSNP:1064596
complement(466)-g, cdbSNP:77689370
470+c, tdbSNP:41557115
472+c, tdbSNP:1059615
478+c, gdbSNP:17885192
complement(481)-g, adbSNP:112201403
487+c, tdbSNP:2308764
complement(489)-t, cdbSNP:74626234
complement(489)-t, cdbSNP:116633902
495+a, gdbSNP:2308765
complement(498)-t, cdbSNP:112796209
complement(504)-g, cdbSNP:111965977
complement(528)-c, adbSNP:78466762
complement(528)-c, adbSNP:111534875
534+a, g, tdbSNP:707954
538+c, tdbSNP:2308767
complement(548)-t, cdbSNP:112408735
complement(554)-t, cdbSNP:75482121
554+a, gdbSNP:2308768
556+g, tdbSNP:63548860
560+a, gdbSNP:2308769
complement(565)-t, cdbSNP:113051160
complement(565)-t, cdbSNP:78767604
571+a, gdbSNP:2308770
complement(574)-g, adbSNP:17850461
577+c, gdbSNP:77637983
complement(577)-g, cdbSNP:113627837
582+a, gdbSNP:1059353
583+c, gdbSNP:2308771
586+c, tdbSNP:1059647
592+c, tdbSNP:62930562
600+c, tdbSNP:1059662
complement(601)-t, gdbSNP:113663708
601+c, tdbSNP:1059665
complement(605)-t, cdbSNP:112116022
complement(613)-t, cdbSNP:79182498
613+a, gdbSNP:1059671
613+a, gdbSNP:16822692
complement(625..626)-, tdbSNP:67077836
627+a, gdbSNP:3205588
628+a, gdbSNP:16822974
complement(628)-t, cdbSNP:75673486
complement(628)-t, cdbSNP:112268155
complement(630)-t, cdbSNP:35300013
complement(630)-, cdbSNP:67687262
633+a, c, gdbSNP:2308775
634+a, gdbSNP:701831
637+a, gdbSNP:1064611
637+a, gdbSNP:16822972
643+a, gdbSNP:2308777
complement(646)-g, adbSNP:17849399
646+c, tdbSNP:17405325
complement(646)-g, adbSNP:111866063
complement(649)-g, adbSNP:34938122
complement(653)-g, cdbSNP:36044702
complement(661)-g, adbSNP:17849968
complement(661)-g, adbSNP:34295373
667+c, tdbSNP:3200488
668+c, gdbSNP:1059699
complement(668)-g, cdbSNP:111739605
670+a, gdbSNP:1059705
complement(670)-t, cdbSNP:17849401
672+c, tdbSNP:17423930
complement(672)-g, adbSNP:115376174
complement(673)-t, cdbSNP:28732329
673+a, gdbSNP:34555743
complement(674)-t, g, cdbSNP:33926824
677+c, gdbSNP:1136846
678+a, c, g, tdbSNP:17885501
679+a, gdbSNP:1071837
complement(682..683)-, cadbSNP:68086438
complement(683..684)-, cadbSNP:35837054
complement(685)-t, cdbSNP:111403823
complement(689)-g, cdbSNP:33936261
complement(695)-, largedeletiondbSNP:71683868
697+a, tdbSNP:78817721
complement(697)-t, adbSNP:112748470
complement(697)-, largedeletiondbSNP:71757220
complement(701)-g, adbSNP:34624872
complement(702)-t, cdbSNP:17856290
complement(748)-g, adbSNP:113175445
773+a, gdbSNP:3830125
775+a, cdbSNP:3830126
779+c, tdbSNP:1059362
781+a, gdbSNP:1059808
complement(784)-g, adbSNP:115775635
complement(785)-t, gdbSNP:115368176
complement(795)-t, cdbSNP:114456878
complement(795)-t, cdbSNP:79558343
complement(795)-t, cdbSNP:71547382
808+a, gdbSNP:1071760
820+c, tdbSNP:35067512
822+a, cdbSNP:17887154
complement(828)-g, cdbSNP:9269744
complement(833)-g, adbSNP:35445101
complement(836)-g, adbSNP:34475960
complement(846)-t, g, cdbSNP:9269693
complement(849)-t, gdbSNP:34955866
complement(855..856)-, gdbSNP:9279724
complement(856)-, gdbSNP:68069105
complement(857)-, gdbSNP:71730912
complement(858..859)-, gdbSNP:41285181
complement(859)-, gdbSNP:71822874
863+c, tdbSNP:1059920
866+a, gdbSNP:1064691
complement(866)-t, cdbSNP:74196494
873+c, tdbSNP:1064692
874+c, tdbSNP:1064694
874+c, tdbSNP:3200773
876+a, tdbSNP:3200775
879+g, tdbSNP:1064695
complement(880)-g, adbSNP:115103320
884+a, gdbSNP:1064697
884+a, gdbSNP:3208370
complement(893)-t, cdbSNP:35324556
894+a, gdbSNP:36217730
complement(901)-t, gdbSNP:35236441
complement(902)-t, cdbSNP:35521457
complement(905..906)-, adbSNP:71810699
906+c, tdbSNP:3200855
906+c, tdbSNP:1064699
907+c, tdbSNP:12363
909+c, tdbSNP:3180268
909+c, tdbSNP:3201237
910+c, g, tdbSNP:3205664
910+g, tdbSNP:3180799
910+g, tdbSNP:16822969
912+c, tdbSNP:3205665
complement(912)-g, adbSNP:9269688
complement(913)-, adbSNP:71864678
917+a, tdbSNP:1064701
918+c, gdbSNP:1141869
918+c, gdbSNP:16822686
920+c, tdbSNP:16822967
920+c, tdbSNP:3200898
929+a, gdbSNP:3200923
complement(930)-g, adbSNP:116358897
931+a, gdbSNP:1060081
complement(937..938)-, cctcdbSNP:34896825
complement(938)-t, cdbSNP:34844328
complement(939)-g, cdbSNP:36084494
complement(944)-g, cdbSNP:34007709
complement(947)-t, gdbSNP:34022924
947+a, cdbSNP:3200956
complement(951)-g, adbSNP:113734598
complement(953)-t, adbSNP:35463048
954+a, gdbSNP:1060129
complement(959)-g, adbSNP:34009233
963+c, tdbSNP:1060150
963+c, tdbSNP:1060362
969+a, gdbSNP:1060153
969+a, g, tdbSNP:1064707
complement(972..973)-, gcdbSNP:34160410
complement(973..974)-, agdbSNP:35165835
973+a, gdbSNP:3200044
complement(985)-t, cdbSNP:112871130
993+c, tdbSNP:1064684
1001+g, tdbSNP:1060173
complement(1001)-c, adbSNP:1732
complement(1005)-g, adbSNP:35716402
1008+c, tdbSNP:1060176
complement(1008)-g, adbSNP:78862599
complement(1009)-g, adbSNP:113804375
1011+a, c, gdbSNP:3173177
complement(1011)-g, cdbSNP:35000099
1013+a, gdbSNP:3200047
1014+c, tdbSNP:1064709
1015+c, tdbSNP:1064710
1016+c, tdbSNP:3208409
complement(1027..1028)-, ggdbSNP:35306263
1028+c, tdbSNP:1060185
complement(1029..1030)-, tdbSNP:66798450
complement(1030..1031)-, tgdbSNP:9281863
complement(1030)-t, gdbSNP:35195677
complement(1031..1032)-, tgdbSNP:71685135
complement(1031)-g, adbSNP:115000072
complement(1032..1033)-, tgdbSNP:113493811
complement(1032)-t, cdbSNP:117447036
1035+a, tdbSNP:1060190
complement(1038)-t, cdbSNP:1730
1039+a, gdbSNP:1064712
complement(1039)-t, cdbSNP:115149483
1042+a, gdbSNP:1064708
complement(1042)-t, cdbSNP:72847688
1046+c, tdbSNP:1064713
1047+a, c, gdbSNP:3201069
complement(1056..1057)-, gdbSNP:34205910
complement(1058)-t, gdbSNP:80136018
complement(1060)-g, cdbSNP:34542752
complement(1070)-g, adbSNP:35263976
complement(1072)-g, adbSNP:118029006
complement(1075..1076)-, adbSNP:71660512
complement(1077)-t, cdbSNP:34306157
1077+a, gdbSNP:3201080
complement(1081)-t, cdbSNP:118126743
complement(1083)-g, adbSNP:1729
complement(1084)-g, cdbSNP:34215479
complement(1085)-g, adbSNP:34900518
1086+c, g, tdbSNP:1064715
complement(1086)-g, cdbSNP:74184083
complement(1086)-g, cdbSNP:75033906
complement(1088)-t, gdbSNP:34923246
complement(1089)-g, adbSNP:35418460
complement(1090)-c, adbSNP:6920823
1097+c, tdbSNP:1064717
1098+a, gdbSNP:3205684
1109+c, tdbSNP:1060270
complement(1111..1112)-, tdbSNP:35078527
complement(1112)-t, gdbSNP:35513414
complement(1113)-g, adbSNP:35413567
complement(1114)-g, cdbSNP:36042073
complement(1116..1117)-, cdbSNP:35993567
complement(1119)-t, cdbSNP:35705303
complement(1120..1121)-gg, cadbSNP:71535483
1120+c, tdbSNP:1141883
complement(1120)-g, adbSNP:74202142
complement(1120)-g, adbSNP:78551490
complement(1121)-g, cdbSNP:77071338
1121+c, gdbSNP:3208415
complement(1122)-t, gdbSNP:34266013
complement(1124..1125)-, ttdbSNP:35136435
complement(1133)-t, cdbSNP:35297326
complement(1153)-t, gdbSNP:114103896
complement(1155)-g, cdbSNP:34839759
Gene SymbolHLA-DRB1
Gene SynonymDRB1; DRw10; FLJ75017; FLJ76359; HLA-DR1B; HLA-DRB; HLA-DRB1*; SS1
Chromosome6
Locus Map6p21.3
All Transcripts NM_002124
Title Genome-wide association study of rheumatoid arthritis in Koreans: population-specific loci as well as overlap with European susceptibility loci .
Author Freudenberg,J., Lee,H.S., Han,B.G., Shin,H.D., Kang,Y.M., Sung,Y.K., Shim,S.C., Choi,C.B., Lee,A.T., Gregersen,P.K. and Bae,S.C.
Journal Arthritis Rheum. 63 (4), 884-893 (2011)
Title Smoking and two human leukocyte antigen genes interact to increase the risk for multiple sclerosis .
Author Hedstrom,A.K., Sundqvist,E., Baarnhielm,M., Nordin,N., Hillert,J., Kockum,I., Olsson,T. and Alfredsson,L.
Journal Brain 134 (PT 3), 653-664 (2011)
Title Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47 .
Author Anderson,C.A., Boucher,G., Lees,C.W., Franke,A., D'Amato,M., Taylor,K.D., Lee,J.C., Goyette,P., Imielinski,M., Latiano,A., Lagace,C., Scott,R., Amininejad,L., Bumpstead,S., Baidoo,L., Baldassano,R.N., Barclay,M., Bayless,T.M., Brand,S., Buning,C., Colombel,J.F., Denson,L.A., De Vos,M., Dubinsky,M., Edwards,C., Ellinghaus,D., Fehrmann,R.S., Floyd,J.A., Florin,T., Franchimont,D., Franke,L., Georges,M., Glas,J., Glazer,N.L., Guthery,S.L., Haritunians,T., Hayward,N.K., Hugot,J.P., Jobin,G., Laukens,D., Lawrance,I., Lemann,M., Levine,A., Libioulle,C., Louis,E., McGovern,D.P., Milla,M., Montgomery,G.W., Morley,K.I., Mowat,C., Ng,A., Newman,W., Ophoff,R.A., Papi,L., Palmieri,O., Peyrin-Biroulet,L., Panes,J., Phillips,A., Prescott,N.J., Proctor,D.D., Roberts,R., Russell,R., Rutgeerts,P., Sanderson,J., Sans,M., Schumm,P., Seibold,F., Sharma,Y., Simms,L.A., Seielstad,M., Steinhart,A.H., Targan,S.R., van den Berg,L.H., Vatn,M., Verspaget,H., Walters,T., Wijmenga,C., Wilson,D.C., Westra,H.J., Xavier,R.J., Zhao,Z.Z., Ponsioen,C.Y., Andersen,V., Torkvist,L., Gazouli,M., Anagnou,N.P., Karlsen,T.H., Kupcinskas,L., Sventoraityte,J., Mansfield,J.C., Kugathasan,S., Silverberg,M.S., Halfvarson,J., Rotter,J.I., Mathew,C.G., Griffiths,A.M., Gearry,R., Ahmad,T., Brant,S.R., Chamaillard,M., Satsangi,J., Cho,J.H., Schreiber,S., Daly,M.J., Barrett,J.C., Parkes,M., Annese,V., Hakonarson,H., Radford-Smith,G., Duerr,R.H., Vermeire,S., Weersma,R.K. and Rioux,J.D.
Journal Nat. Genet. 43 (3), 246-252 (2011)
Title Genome-wide association study identifies susceptibility loci for IgA nephropathy .
Author Gharavi,A.G., Kiryluk,K., Choi,M., Li,Y., Hou,P., Xie,J., Sanna-Cherchi,S., Men,C.J., Julian,B.A., Wyatt,R.J., Novak,J., He,J.C., Wang,H., Lv,J., Zhu,L., Wang,W., Wang,Z., Yasuno,K., Gunel,M., Mane,S., Umlauf,S., Tikhonova,I., Beerman,I., Savoldi,S., Magistroni,R., Ghiggeri,G.M., Bodria,M., Lugani,F., Ravani,P., Ponticelli,C., Allegri,L., Boscutti,G., Frasca,G., Amore,A., Peruzzi,L., Coppo,R., Izzi,C., Viola,B.F., Prati,E., Salvadori,M., Mignani,R., Gesualdo,L., Bertinetto,F., Mesiano,P., Amoroso,A., Scolari,F., Chen,N., Zhang,H. and Lifton,R.P.
Journal Nat. Genet. 43 (4), 321-327 (2011)
Title Bimodal distribution of RNA expression levels in human skeletal muscle tissue .
Author Mason,C.C., Hanson,R.L., Ossowski,V., Bian,L., Baier,L.J., Krakoff,J. and Bogardus,C.
Journal BMC Genomics 12, 98 (2011)
Title HLA-DRB1 first domain sequence for a novel DR4 allele designated DRB1*0413 .
Author Petersdorf,E.W., Smith,A.G., Martin,P.J. and Hansen,J.A.
Journal Tissue Antigens 40 (5), 267-268 (1992)
Title Molecular analysis of HLA-DRB1*08/12 alleles: identification of two additional alleles .
Author Eberle,M. and Baxter-Lowe,L.A.
Journal Hum. Immunol. 34 (1), 24-30 (1992)
Title Molecular genetic analysis of HLA-DR and HLA-DQ genes among anti-U1-70-kd autoantibody positive connective tissue disease patients .
Author Kaneoka,H., Hsu,K.C., Takeda,Y., Sharp,G.C. and Hoffman,R.W.
Journal Arthritis Rheum. 35 (1), 83-94 (1992)
Title The evolutionary origin of the HLA-DR3 haplotype .
Author Vincek,V., Klein,D., Figueroa,F., Hauptfeld,V., Kasahara,M., O'hUigin,C., Mach,B. and Klein,J.
Journal Immunogenetics 35 (4), 263-271 (1992)
Title Mhc-DRB diversity of the chimpanzee (Pan troglodytes) .
Author Kenter,M., Otting,N., Anholts,J., Jonker,M., Schipper,R. and Bontrop,R.E.
Journal Immunogenetics 37 (1), 1-11 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878