• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu32855 Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu32855C Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002124.3, 345461077
Length 801 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), transcript variant 1, mRNA.
Product major histocompatibility complex, class II, DR beta 1 precursor
Comment

Summary: HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa. It is encoded by 6 exons. Exon one encodes the leader peptide; exons 2 and 3 encode the two extracellular domains; exon 4 encodes the transmembrane domain; and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Hundreds of DRB1 alleles have been described and typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogs DRB3, DRB4 and DRB5. DRB1 is present in all individuals. Allelic variants of DRB1 are linked with either none or one of the genes DRB3, DRB4 and DRB5. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the DRB1*15:01:01:01 allele of the HLA-DRB1 gene, as represented in the assembled chromosome 6 in the primary assembly of the reference genome.

RefSeq NP_002115.2
CDS 95..895
Misc Feature(1)47..49
Misc Feature(2)182..466
Misc Feature(3)221..442
Misc Feature(4)467..775
Misc Feature(5)470..751
Misc Feature(6)order(485..487,539..544,548..550,626..649)
Misc Feature(7)order(548..550,632..640,644..646)
Misc Feature(8)776..838
Exon (1)1..194
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Exon (2)195..464
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Exon (3)465..746
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Exon (4)747..857
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Exon (5)858..881
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Exon (6)882..1217
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Translation MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYF YNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTV QRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL FLGAGLFIYFRNQKGHSGLQPTGFLS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(2)-dbSNP:
complement(2)-, gdbSNP:201273461
complement(8)-g, adbSNP:17211105
complement(25..26)-, tdbSNP:28383887
complement(28..29)-, cdbSNP:199616059
complement(29)-c, adbSNP:17211091
complement(30..31)-, gdbSNP:34230188
complement(30)-g, c, adbSNP:17211084
complement(46)-c, adbSNP:17204758
complement(54)-g, adbSNP:28366221
complement(55)-t, cdbSNP:28366220
62+c, g, tdbSNP:1059546
complement(65)-g, cdbSNP:17204744
complement(68)-t, cdbSNP:17204737
complement(71)-t, gdbSNP:17211078
complement(78)-g, adbSNP:17211071
complement(80)-c, adbSNP:138717279
85+c, gdbSNP:1059547
complement(104)-g, adbSNP:201125976
complement(108)-g, adbSNP:707953
complement(110)-t, cdbSNP:17879020
complement(111)-g, adbSNP:201726340
complement(112)-t, gdbSNP:374594903
complement(117)-t, cdbSNP:111934004
complement(125)-t, adbSNP:199514452
complement(127)-g, adbSNP:34396110
complement(128)-t, adbSNP:201540428
complement(131)-t, cdbSNP:9270303
134+a, gdbSNP:17878475
complement(135)-g, c, adbSNP:9270302
complement(136)-c, adbSNP:9270301
complement(137)-g, adbSNP:150644773
complement(149)-g, adbSNP:34187469
complement(153)-g, adbSNP:35053532
complement(165)-g, adbSNP:187619904
complement(168)-g, cdbSNP:148093782
complement(178)-g, cdbSNP:201614260
complement(179)-c, adbSNP:9270299
complement(185)-t, cdbSNP:372634318
complement(186)-t, cdbSNP:201700261
complement(191)-t, gdbSNP:9256943
complement(192)-g, adbSNP:17879746
197+dbSNP:
197+c, gdbSNP:41308497
complement(206)-t, g, c, adbSNP:9269959
complement(207)-t, cdbSNP:9269958
complement(209)-g, c, adbSNP:9269957
complement(211)-g, cdbSNP:9269956
complement(212)-t, g, c, adbSNP:9269955
213+a, c, g, tdbSNP:17878703
216+a, cdbSNP:17433870
216+a, c, g, tdbSNP:1136756
217+a, gdbSNP:17887028
218+a, c, g, tdbSNP:1136758
219+a, c, g, tdbSNP:1136759
219+c, gdbSNP:17424090
complement(220)-c, adbSNP:9269951
221+a, gdbSNP:17882014
223+a, gdbSNP:17885011
227+c, tdbSNP:17879702
229+a, tdbSNP:17879981
complement(233)-g, adbSNP:114435757
235+c, tdbSNP:45600431
239+c, gdbSNP:61759931
240+c, gdbSNP:17879469
242+a, tdbSNP:61759932
243+a, cdbSNP:61759933
244+c, gdbSNP:17881146
248+a, c, gdbSNP:74812266
249+c, gdbSNP:17882378
complement(250)-t, cdbSNP:191828595
complement(251..256)-, ccgcacdbSNP:201929829
complement(254)-g, adbSNP:188617679
255+a, g, tdbSNP:17885382
256+g, tdbSNP:74481206
complement(257)-t, adbSNP:201128876
258+a, tdbSNP:16822516
261+a, c, g, tdbSNP:17878671
263+c, g, tdbSNP:17878947
complement(264)-t, adbSNP:200532329
265+a, c, gdbSNP:1059575
268+a, tdbSNP:17878437
269+c, tdbSNP:11554462
270+a, g, tdbSNP:3175105
271+c, tdbSNP:17884729
272+a, g, tdbSNP:17882300
275+c, g, tdbSNP:1064664
278+a, cdbSNP:17879995
278+a, cdbSNP:397764410
280+a, c, tdbSNP:17879242
282+a, gdbSNP:17879476
283+a, gdbSNP:17882603
285+a, gdbSNP:55655909
286+a, gdbSNP:17885071
289+a, gdbSNP:17882641
290+a, c, g, tdbSNP:16822820
291+a, c, tdbSNP:17883134
292+c, tdbSNP:72558164
293+c, g, tdbSNP:17878614
complement(293)-, cdbSNP:200676666
294+c, tdbSNP:17878951
297+a, gdbSNP:17886928
298+c, gdbSNP:17885772
300+a, tdbSNP:17882455
302+a, gdbSNP:56158521
complement(307)-g, adbSNP:183889763
310+c, tdbSNP:75044270
complement(311)-t, cdbSNP:150747106
313+a, gdbSNP:72558165
314+a, c, gdbSNP:17885437
319+c, gdbSNP:17882006
320+c, tdbSNP:29029548
321+a, tdbSNP:17884945
322+c, tdbSNP:17879688
323+a, c, tdbSNP:17879937
324+a, g, tdbSNP:17886436
325+a, gdbSNP:55917654
327+a, c, tdbSNP:17879432
328+a, gdbSNP:35499948
329+g, tdbSNP:17885257
330+c, tdbSNP:17885908
334+a, g, tdbSNP:17880973
335+a, g, tdbSNP:17883065
338+a, cdbSNP:72558166
340+a, gdbSNP:17878622
344+c, tdbSNP:17878902
345+g, tdbSNP:41308498
347+c, gdbSNP:17887012
complement(348)-g, adbSNP:201749971
349+c, tdbSNP:72558167
350+a, gdbSNP:17880292
351+a, c, g, tdbSNP:17885129
complement(352)-g, c, adbSNP:17853228
353+a, c, gdbSNP:1059583
354+a, c, g, tdbSNP:1059584
complement(355)-g, c, adbSNP:17853229
356+c, gdbSNP:17879954
357+a, gdbSNP:17879230
358+a, c, gdbSNP:17886514
359+a, c, tdbSNP:17882583
360+a, cdbSNP:1059586
complement(367)-g, adbSNP:201721658
369+a, gdbSNP:41508449
372+a, gdbSNP:17882098
373+, gdbSNP:17885020
374+, adbSNP:17878577
375+, adbSNP:397844204
377+a, gdbSNP:17878874
380+a, c, tdbSNP:17886918
383+c, tdbSNP:17881176
384+g, tdbSNP:41308499
387+a, gdbSNP:17882450
complement(388..389)-, tcdbSNP:28986201
388+a, gdbSNP:17885388
389+c, gdbSNP:17881965
390+a, gdbSNP:17884070
complement(391..392)-, ttdbSNP:200320734
391+c, gdbSNP:17879599
complement(393)-t, g, cdbSNP:9269942
394+a, gdbSNP:17880366
complement(395..396)-, cgdbSNP:9281873
395+c, g, tdbSNP:17885222
396+a, c, g, tdbSNP:17885869
complement(397..398)-, ccdbSNP:67187877
397+c, g, tdbSNP:17884749
398+, gdbSNP:370743542
398+g, tdbSNP:17883297
400+a, c, g, tdbSNP:3208330
401+a, c, gdbSNP:16822805
402+a, c, g, tdbSNP:17886882
complement(402)-, gdbSNP:67476479
403+a, c, gdbSNP:17880261
407+a, gdbSNP:61759934
410+a, gdbSNP:17885079
complement(411)-t, gdbSNP:9269941
412+c, tdbSNP:16822512
413+c, g, tdbSNP:17884043
414+a, tdbSNP:17879620
415+a, c, g, tdbSNP:11554463
422+c, tdbSNP:29029549
430+c, tdbSNP:45542832
431+a, c, gdbSNP:17879213
433+a, gdbSNP:17885752
435+c, tdbSNP:17424145
437+a, gdbSNP:61759935
438+a, g, tdbSNP:17885482
439+g, tdbSNP:17882028
445+a, cdbSNP:17883271
454+c, gdbSNP:45594032
458+a, cdbSNP:17879125
complement(458)-c, adbSNP:386545000
460+a, gdbSNP:17878311
464+a, gdbSNP:17885959
complement(466)-dbSNP:
complement(466)-g, adbSNP:140866337
467+c, g, tdbSNP:17882084
469+a, g, tdbSNP:1071752
471+g, tdbSNP:79706935
472+c, tdbSNP:62799161
complement(475)-t, g, c, adbSNP:17424180
477+c, g, tdbSNP:80190494
478+c, tdbSNP:74944677
479+a, c, gdbSNP:1136791
480+a, gdbSNP:76895951
481+a, gdbSNP:62889561
484+a, gdbSNP:2308759
484+a, gdbSNP:17405226
complement(488)-g, adbSNP:148699775
491+g, tdbSNP:2308760
complement(492..493)-, tdbSNP:35616319
complement(492)-g, adbSNP:201929247
493+a, cdbSNP:2308761
complement(495..496)-, tdbSNP:200088269
complement(496)-t, cdbSNP:200078051
complement(498)-t, gdbSNP:200516145
499+a, c, g, tdbSNP:17401330
505+c, tdbSNP:1064596
complement(517)-g, c, adbSNP:77689370
521+c, tdbSNP:41557115
529+c, gdbSNP:17885192
532+c, tdbSNP:2308764
complement(532)-g, adbSNP:112201403
complement(540)-t, cdbSNP:74626234
complement(549)-t, cdbSNP:112796209
complement(560)-t, cdbSNP:202047044
579+a, g, tdbSNP:707954
complement(579)-t, c, adbSNP:78466762
583+c, tdbSNP:2308767
complement(604..606)-, atcdbSNP:199824918
607+g, tdbSNP:63548860
611+a, gdbSNP:2308769
complement(616)-t, cdbSNP:78767604
622+a, gdbSNP:2308770
628+c, gdbSNP:77637983
634+c, gdbSNP:2308771
643+c, tdbSNP:62930562
complement(652)-t, gdbSNP:113663708
complement(656)-t, cdbSNP:112116022
664+a, gdbSNP:16822692
678+a, gdbSNP:3205588
679+a, gdbSNP:701831
679+a, gdbSNP:16822974
complement(681)-t, cdbSNP:35300013
complement(687..706)-, cacttggcaggtgtaaacctdbSNP:140357311
688+a, gdbSNP:16822972
694+a, gdbSNP:2308777
697+c, tdbSNP:17405325
complement(700)-g, adbSNP:34938122
complement(704)-g, cdbSNP:36044702
complement(718)-g, adbSNP:199704140
721+a, gdbSNP:1059705
complement(723)-g, adbSNP:200809587
complement(724)-t, g, c, adbSNP:28732329
complement(725)-g, cdbSNP:33926824
730+a, gdbSNP:1071837
complement(734..735)-, cadbSNP:35837054
complement(736)-t, cdbSNP:111403823
complement(740)-g, cdbSNP:33936261
complement(748)-dbSNP:
complement(748)-t, adbSNP:1136881
748+a, tdbSNP:78817721
complement(752)-g, adbSNP:34624872
complement(753)-t, cdbSNP:17856290
753+a, gdbSNP:397832555
complement(765)-t, gdbSNP:377738927
complement(768)-t, cdbSNP:374360042
complement(790)-g, adbSNP:368802150
complement(799)-g, adbSNP:113175445
complement(800)-t, cdbSNP:201698383
824+a, gdbSNP:3830125
826+a, cdbSNP:3830126
complement(835)-g, adbSNP:201168487
complement(836)-t, gdbSNP:199873800
complement(846)-t, cdbSNP:71547382
complement(874)-t, cdbSNP:192487435
complement(884)-dbSNP:
complement(884)-g, adbSNP:35445101
complement(887)-g, adbSNP:34475960
complement(897)-t, g, cdbSNP:9269693
complement(900)-t, gdbSNP:34955866
complement(908)-t, gdbSNP:201099263
complement(908)-, gdbSNP:68069105
complement(910..911)-, tgdbSNP:372075270
914+c, tdbSNP:1059920
917+a, gdbSNP:1064691
complement(920)-t, cdbSNP:202053852
complement(921)-t, cdbSNP:201375698
924+c, tdbSNP:1064692
925+c, tdbSNP:1064694
complement(927)-t, adbSNP:200538592
930+g, tdbSNP:1064695
931+c, tdbSNP:36217728
935+a, gdbSNP:1064697
complement(939)-g, adbSNP:200849525
complement(942)-t, gdbSNP:146292738
complement(944)-t, cdbSNP:35324556
945+a, gdbSNP:36217730
complement(952)-t, gdbSNP:35236441
complement(953)-t, cdbSNP:35521457
957+c, tdbSNP:1064699
958+c, g, tdbSNP:12363
complement(959..960)-, ggagdbSNP:368419083
960+c, tdbSNP:3180268
961+a, c, g, tdbSNP:3180799
complement(963)-g, adbSNP:9269688
complement(964)-, adbSNP:71864678
968+a, tdbSNP:1064701
969+c, gdbSNP:1141869
971+c, tdbSNP:3200898
complement(980)-t, cdbSNP:182030800
complement(981)-g, adbSNP:116358897
982+a, gdbSNP:1060081
complement(989)-t, cdbSNP:34844328
complement(990)-g, cdbSNP:36084494
complement(995)-g, cdbSNP:34007709
complement(998)-t, g, adbSNP:34022924
complement(1002)-g, adbSNP:113734598
complement(1004)-t, adbSNP:35463048
1005+a, gdbSNP:1060129
complement(1010)-g, adbSNP:34009233
1020+a, g, tdbSNP:1064707
complement(1023..1024)-, gcdbSNP:34160410
complement(1024..1025)-, agdbSNP:35165835
1024+a, g, tdbSNP:3200044
complement(1025..1026)-, agdbSNP:368203982
complement(1026..1027)-, agdbSNP:148582499
complement(1036)-t, cdbSNP:112871130
1037+a, gdbSNP:142078339
complement(1052)-c, adbSNP:1732
complement(1056)-g, adbSNP:35716402
1059+c, tdbSNP:1060176
complement(1060)-g, adbSNP:113804375
complement(1062)-g, cdbSNP:35000099
1064+a, gdbSNP:3200047
1065+c, tdbSNP:1064709
1066+c, tdbSNP:1064710
1067+c, tdbSNP:3208409
complement(1078..1079)-, ggdbSNP:35306263
1079+c, tdbSNP:1060185
complement(1081..1082)-, tgdbSNP:9281863
complement(1081)-t, gdbSNP:35195677
complement(1082..1083)-, tgdbSNP:71685135
complement(1083..1084)-, tgdbSNP:113493811
1086+a, tdbSNP:1060190
complement(1089)-t, cdbSNP:1730
1090+a, gdbSNP:1064712
1093+a, gdbSNP:34981130
1097+c, tdbSNP:1064713
1098+a, c, gdbSNP:3201069
complement(1107..1108)-, gdbSNP:34205910
complement(1108..1109)-, gdbSNP:199703384
complement(1109)-t, gdbSNP:80136018
complement(1111)-g, cdbSNP:34542752
complement(1121)-g, adbSNP:35263976
complement(1128)-g, adbSNP:3201080
complement(1132)-t, cdbSNP:118126743
complement(1134)-t, g, adbSNP:1729
complement(1135)-g, cdbSNP:34215479
complement(1136)-g, adbSNP:34900518
1137+c, g, tdbSNP:1064715
complement(1139)-t, gdbSNP:34923246
complement(1140)-g, adbSNP:35418460
complement(1141)-c, adbSNP:6920823
complement(1144)-t, gdbSNP:185448040
complement(1147..1154)-, atgcacggdbSNP:200428856
1148+c, tdbSNP:1064717
1149+a, gdbSNP:3205684
1160+c, tdbSNP:1060270
complement(1163)-t, gdbSNP:35513414
complement(1164)-g, adbSNP:35413567
complement(1165)-g, cdbSNP:36042073
complement(1170)-t, cdbSNP:35705303
complement(1171..1172)-gg, cadbSNP:71535483
1171+c, tdbSNP:1141883
complement(1172..1173)-, ggdbSNP:369671770
complement(1173)-t, gdbSNP:34266013
complement(1184)-t, cdbSNP:35297326
complement(1204)-t, gdbSNP:114103896
complement(1206)-g, cdbSNP:34839759
Gene SymbolHLA-DRB1
Gene SynonymDRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Chromosome6
Locus Map6p21.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002124 Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_001243965 Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), transcript variant 2, mRNA. In-stock $99.00 5-7
XM_006710243 PREDICTED: Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), mRNA. On-demand $159.00 7-9
Title Interaction between adolescent obesity and HLA risk genes in the etiology of multiple sclerosis .
Author Hedstrom AK, Lima Bomfim I, Barcellos L, Gianfrancesco M, Schaefer C, Kockum I, Olsson T and Alfredsson L.
Journal Neurology 82 (10), 865-872 (2014)
Title HLA-DR, DQ class II DNA typing in pediatric panuveitis and tubulointerstitial nephritis and uveitis .
Author Reddy AK, Hwang YS, Mandelcorn ED and Davis JL.
Journal Am. J. Ophthalmol. 157 (3), 678-686 (2014)
Title Novel rheumatoid arthritis susceptibility locus at 22q12 identified in an extended UK genome-wide association study .
Author Orozco G, Viatte S, Bowes J, Martin P, Wilson AG, Morgan AW, Steer S, Wordsworth P, Hocking LJ, Barton A, Worthington J and Eyre S.
Journal Arthritis Rheumatol 66 (1), 24-30 (2014)
Title HLA-DRB1 associations with rheumatoid arthritis-related pulmonary fibrosis .
Author Ennis H, Gupta A, Dawson J, Lunt M, Thomson W and Herrick A.
Journal Scand. J. Rheumatol. 43 (1), 75-76 (2014)
Title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis .
Author Scally SW, Petersen J, Law SC, Dudek NL, Nel HJ, Loh KL, Wijeyewickrema LC, Eckle SB, van Heemst J, Pike RN, McCluskey J, Toes RE, La Gruta NL, Purcell AW, Reid HH, Thomas R and Rossjohn J.
Journal J. Exp. Med. 210 (12), 2569-2582 (2013)
Title HLA-DRB1 first domain sequence for a novel DR4 allele designated DRB1*0413 .
Author Petersdorf EW, Smith AG, Martin PJ and Hansen JA.
Journal Tissue Antigens 40 (5), 267-268 (1992)
Title Molecular analysis of HLA-DRB1*08/12 alleles: identification of two additional alleles .
Author Eberle M and Baxter-Lowe LA.
Journal Hum. Immunol. 34 (1), 24-30 (1992)
Title Molecular genetic analysis of HLA-DR and HLA-DQ genes among anti-U1-70-kd autoantibody positive connective tissue disease patients .
Author Kaneoka H, Hsu KC, Takeda Y, Sharp GC and Hoffman RW.
Journal Arthritis Rheum. 35 (1), 83-94 (1992)
Title The evolutionary origin of the HLA-DR3 haplotype .
Author Vincek V, Klein D, Figueroa F, Hauptfeld V, Kasahara M, O'hUigin C, Mach B and Klein J.
Journal Immunogenetics 35 (4), 263-271 (1992)
Title Mhc-DRB diversity of the chimpanzee (Pan troglodytes) .
Author Kenter M, Otting N, Anholts J, Jonker M, Schipper R and Bontrop RE.
Journal Immunogenetics 37 (1), 1-11 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.