• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002124 Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_002124.3, 345461077
Length 1280 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), transcript variant 1, mRNA.
Product major histocompatibility complex, class II, DR beta 1 precursor
Comment

Summary: HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa. It is encoded by 6 exons. Exon one encodes the leader peptide; exons 2 and 3 encode the two extracellular domains; exon 4 encodes the transmembrane domain; and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Hundreds of DRB1 alleles have been described and typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogs DRB3, DRB4 and DRB5. DRB1 is present in all individuals. Allelic variants of DRB1 are linked with either none or one of the genes DRB3, DRB4 and DRB5. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the DRB1*15:01:01:01 allele of the HLA-DRB1 gene, as represented in the assembled chromosome 6 in the primary assembly of the reference genome.

RefSeq NP_002115.2
CDS 95..895
Misc Feature(1)47..49
Misc Feature(2)182..466
Misc Feature(3)221..442
Misc Feature(4)467..775
Misc Feature(5)470..751
Misc Feature(6)776..838
Exon (1)1..194
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Exon (2)195..464
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Exon (3)465..746
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Exon (4)747..857
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Exon (5)858..881
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Exon (6)882..1217
Gene:HLA-DRB1
Gene Synonym:DRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Translation MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYF YNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTV QRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL FLGAGLFIYFRNQKGHSGLQPTGFLS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(1..3)-dbSNP:
complement(1..3)-, gdbSNP:36173580
complement(2)-, gdbSNP:201273461
complement(8)-g, adbSNP:17211105
complement(12)-g, adbSNP:16822887
complement(24..25)-, tdbSNP:66674928
complement(25..26)-, tdbSNP:28383887
complement(26)-g, adbSNP:35683586
complement(28..29)-, cdbSNP:199616059
complement(29)-c, adbSNP:17211091
complement(30..31)-, gdbSNP:34230188
complement(30)-g, c, adbSNP:17211084
complement(46)-c, adbSNP:17204758
complement(54)-g, adbSNP:28366221
complement(55)-t, cdbSNP:28366220
complement(62)-t, g, cdbSNP:1059546
complement(65)-g, cdbSNP:17204744
complement(68)-t, cdbSNP:17204737
complement(71)-t, gdbSNP:17211078
complement(78)-g, adbSNP:17211071
complement(80)-c, adbSNP:138717279
complement(85)-g, cdbSNP:1059547
complement(104)-g, adbSNP:201125976
complement(108)-g, adbSNP:707953
complement(110)-t, cdbSNP:17879020
complement(110)-t, cdbSNP:34959058
complement(111)-g, adbSNP:201726340
complement(117)-t, cdbSNP:111934004
complement(121)-t, cdbSNP:1059549
complement(124)-c, adbSNP:11537928
complement(125)-t, adbSNP:1059550
complement(125)-t, adbSNP:199514452
complement(126)-g, adbSNP:1059551
complement(127)-g, adbSNP:17211050
complement(127)-g, adbSNP:34396110
complement(128)-t, adbSNP:1059552
complement(128)-t, adbSNP:201540428
complement(131)-t, cdbSNP:9270303
complement(134)-g, adbSNP:17878475
complement(135)-g, c, adbSNP:9270302
complement(136)-c, adbSNP:9270301
complement(137)-g, adbSNP:150644773
complement(149)-g, adbSNP:17204709
complement(149)-g, adbSNP:34187469
complement(153)-g, adbSNP:35053532
complement(165)-g, adbSNP:187619904
complement(168)-g, cdbSNP:1059556
complement(168)-g, cdbSNP:148093782
complement(178)-g, cdbSNP:201614260
complement(179)-c, adbSNP:9270299
complement(186)-t, cdbSNP:201700261
complement(191)-t, gdbSNP:9256943
complement(192)-t, cdbSNP:17211022
complement(192)-g, adbSNP:17879746
complement(197)-dbSNP:
complement(197)-g, cdbSNP:41308497
complement(203)-g, adbSNP:9269960
complement(204)-t, cdbSNP:41548620
complement(205)-g, cdbSNP:41542913
complement(206)-t, g, c, adbSNP:9269959
complement(207)-t, cdbSNP:9269958
complement(209)-g, c, adbSNP:9269957
complement(210)-t, adbSNP:17882663
complement(211)-g, cdbSNP:9269956
complement(212)-t, g, c, adbSNP:9269955
complement(213)-t, g, c, adbSNP:17878703
complement(216)-t, g, c, adbSNP:1136756
complement(217)-g, adbSNP:17887028
complement(218)-t, g, c, adbSNP:1136758
complement(219)-t, g, c, adbSNP:1136759
complement(220)-c, adbSNP:9269951
complement(221)-g, adbSNP:17882014
complement(223)-g, adbSNP:17885011
complement(227)-t, cdbSNP:17879702
complement(229)-t, adbSNP:17879981
complement(233)-g, adbSNP:114435757
complement(235)-t, cdbSNP:45600431
complement(238)-t, cdbSNP:1136763
complement(239)-g, cdbSNP:61759931
complement(240)-g, cdbSNP:17879469
complement(242)-t, adbSNP:61759932
complement(243)-c, adbSNP:61759933
complement(244)-g, cdbSNP:17881146
complement(248)-g, c, adbSNP:74812266
complement(249)-g, cdbSNP:17882378
complement(250..255)-, cgcaccdbSNP:66939620
complement(250)-t, cdbSNP:191828595
complement(251..256)-, ccgcacdbSNP:201929829
complement(254)-g, adbSNP:188617679
complement(255)-t, g, adbSNP:17885382
complement(256)-t, gdbSNP:74481206
complement(257)-t, cdbSNP:41546217
complement(257)-t, adbSNP:201128876
complement(258)-t, adbSNP:1059569
complement(258)-t, adbSNP:16822516
complement(259)-t, g, c, adbSNP:1059572
complement(261..262)-, cadbSNP:67244437
complement(261)-t, g, c, adbSNP:17878671
complement(263)-t, g, cdbSNP:17878947
complement(263)-g, c, adbSNP:1059573
complement(264)-t, adbSNP:200532329
complement(265)-g, c, adbSNP:1059575
complement(267)-t, gdbSNP:41541016
complement(268)-t, adbSNP:17878437
complement(269)-t, cdbSNP:11554462
complement(269)-g, adbSNP:113465897
complement(270)-t, g, adbSNP:3175105
complement(270)-t, g, adbSNP:17882777
complement(271)-t, cdbSNP:17884729
complement(272)-t, g, adbSNP:17882300
complement(274)-t, cdbSNP:78927247
complement(275)-t, g, cdbSNP:1064664
complement(278)-c, adbSNP:17879995
complement(280)-t, c, adbSNP:17879242
complement(282)-g, adbSNP:17879476
complement(283)-g, adbSNP:17882603
complement(285)-g, adbSNP:55655909
complement(286)-g, adbSNP:17885071
complement(289)-g, adbSNP:17882641
complement(290)-t, g, c, adbSNP:707956
complement(290)-t, g, c, adbSNP:16822820
complement(291)-t, c, adbSNP:17883134
complement(292)-t, cdbSNP:72558164
complement(293)-t, g, cdbSNP:1059580
complement(293)-t, g, cdbSNP:17878614
complement(293)-, cdbSNP:200676666
complement(294)-t, cdbSNP:17878951
complement(296)-c, adbSNP:41562815
complement(297)-g, adbSNP:17886928
complement(298)-g, cdbSNP:17885772
complement(300)-t, adbSNP:17882455
complement(302)-g, adbSNP:56158521
complement(306)-c, adbSNP:11550037
complement(307)-g, adbSNP:183889763
complement(310)-t, cdbSNP:75044270
complement(311)-t, cdbSNP:150747106
complement(313)-g, adbSNP:72558165
complement(314)-g, c, adbSNP:17885437
complement(316)-t, gdbSNP:41550020
complement(319)-g, cdbSNP:17882006
complement(320)-t, cdbSNP:29029548
complement(321)-t, adbSNP:17884945
complement(322)-t, cdbSNP:17879688
complement(323)-t, c, adbSNP:17879937
complement(324)-t, g, adbSNP:17886436
complement(325)-g, adbSNP:55917654
complement(327)-t, c, adbSNP:17879432
complement(328)-g, adbSNP:35499948
complement(329)-t, gdbSNP:17885257
complement(330)-t, cdbSNP:17885908
complement(333)-t, g, cdbSNP:1059582
complement(333)-g, cdbSNP:41543012
complement(334)-t, g, adbSNP:17880973
complement(335)-t, g, adbSNP:17883065
complement(338)-c, adbSNP:72558166
complement(340)-g, adbSNP:1059349
complement(340)-g, adbSNP:17878622
complement(344)-t, cdbSNP:17878902
complement(345)-t, gdbSNP:41308498
complement(345)-t, gdbSNP:61759930
complement(347)-g, cdbSNP:17887012
complement(348)-g, adbSNP:201749971
complement(349)-t, cdbSNP:72558167
complement(350)-g, adbSNP:17880292
complement(350)-g, adbSNP:41546816
complement(351)-t, g, c, adbSNP:17885129
complement(351)-t, g, c, adbSNP:41553717
complement(352)-g, c, adbSNP:17853228
complement(353)-g, c, adbSNP:1059583
complement(354)-t, g, c, adbSNP:1059584
complement(354)-c, adbSNP:41545613
complement(355)-g, c, adbSNP:17853229
complement(356)-g, cdbSNP:17879954
complement(357)-g, adbSNP:17879230
complement(358)-g, c, adbSNP:17886514
complement(359)-t, cdbSNP:41550514
complement(359)-t, c, adbSNP:17882583
complement(360)-c, adbSNP:1059586
complement(360)-c, adbSNP:41550013
complement(367)-g, adbSNP:201721658
complement(369)-g, adbSNP:41508449
complement(372)-g, adbSNP:17882098
complement(373)-, gdbSNP:17885020
complement(375)-, adbSNP:17878577
complement(377)-g, adbSNP:17878874
complement(380)-t, c, adbSNP:17886918
complement(383)-t, cdbSNP:17881176
complement(384)-t, gdbSNP:41308499
complement(386..387)-, tdbSNP:71827189
complement(387..388)-, tdbSNP:71689970
complement(387)-g, adbSNP:17882450
complement(388..389)-, tcdbSNP:28986201
complement(388)-g, adbSNP:17885388
complement(389)-g, cdbSNP:17881965
complement(390..391)-, ttdbSNP:66585153
complement(390)-g, adbSNP:17884070
complement(391..392)-, ttdbSNP:200320734
complement(391)-g, cdbSNP:17879599
complement(392)-t, g, c, adbSNP:1064592
complement(393)-t, g, cdbSNP:9269942
complement(393)-g, c, adbSNP:16822853
complement(394..395)-, gdbSNP:28993507
complement(394)-g, adbSNP:17880366
complement(395..396)-, cg, cdbSNP:9281873
complement(395)-t, g, cdbSNP:17885222
complement(395)-, g, gcdbSNP:67798196
complement(396)-t, g, c, adbSNP:17885869
complement(397..398)-, ccdbSNP:67187877
complement(397)-t, g, cdbSNP:17884749
complement(398..399)-g, cdbSNP:78470207
complement(398)-t, gdbSNP:17883297
complement(399)-g, cdbSNP:1059596
complement(399)-g, cdbSNP:17878857
complement(400)-t, g, c, adbSNP:3208330
complement(401)-g, cdbSNP:199955875
complement(401)-g, c, adbSNP:16822805
complement(402)-t, g, c, adbSNP:17886882
complement(402)-, gdbSNP:67476479
complement(402)-g, adbSNP:2308805
complement(402)-c, adbSNP:78769091
complement(403)-g, c, adbSNP:17880261
complement(407)-g, adbSNP:61759934
complement(410)-g, adbSNP:17885079
complement(411)-t, gdbSNP:9269941
complement(411)-t, gdbSNP:77700591
complement(411)-t, c, adbSNP:707959
complement(411)-c, adbSNP:16822752
complement(412)-t, cdbSNP:707960
complement(412)-t, cdbSNP:16822512
complement(413)-t, g, cdbSNP:17884043
complement(414)-t, adbSNP:17879620
complement(415)-t, g, c, adbSNP:11554463
complement(421)-g, adbSNP:41553314
complement(422)-t, cdbSNP:29029549
complement(430)-t, cdbSNP:45542832
complement(431)-g, cdbSNP:80208538
complement(431)-g, c, adbSNP:17879213
complement(433)-g, c, adbSNP:41548219
complement(433)-g, adbSNP:17885752
complement(435)-t, cdbSNP:17424145
complement(437)-t, g, cdbSNP:2230810
complement(437)-g, adbSNP:61759935
complement(437)-c, adbSNP:77607269
complement(438)-t, gdbSNP:2230811
complement(438)-t, g, adbSNP:17885482
complement(438)-c, adbSNP:77472364
complement(439)-t, gdbSNP:17882028
complement(445)-c, adbSNP:17883271
complement(451)-t, cdbSNP:79608093
complement(451)-g, adbSNP:1136782
complement(454)-g, cdbSNP:45594032
complement(458)-c, adbSNP:17879125
complement(458)-c, adbSNP:35760648
complement(460)-g, adbSNP:17878311
complement(464)-g, adbSNP:17885959
complement(466)-dbSNP:
complement(466)-g, adbSNP:140866337
complement(467)-g, cdbSNP:201283616
complement(469)-t, g, adbSNP:1071752
complement(471)-t, gdbSNP:79706935
complement(472)-t, cdbSNP:62799161
complement(473)-t, g, c, adbSNP:17405219
complement(475)-t, g, c, adbSNP:17424180
complement(477)-t, g, cdbSNP:80190494
complement(478)-t, cdbSNP:74944677
complement(479)-g, c, adbSNP:1136791
complement(480)-g, adbSNP:76895951
complement(481)-g, adbSNP:62889561
complement(484)-t, cdbSNP:111823233
complement(488)-g, adbSNP:148699775
complement(490)-g, adbSNP:17405226
complement(491)-c, adbSNP:201687664
complement(492)-g, adbSNP:201929247
complement(493)-t, gdbSNP:201597010
complement(494..495)-, tdbSNP:35616319
complement(495..496)-, tdbSNP:200088269
complement(496)-t, cdbSNP:200078051
complement(497)-t, g, adbSNP:17433947
complement(498)-t, gdbSNP:200516145
complement(499..500)-, gdbSNP:34749207
complement(499)-t, g, c, adbSNP:17401330
complement(500)-, gdbSNP:67245200
complement(505)-t, cdbSNP:1064596
complement(517)-g, c, adbSNP:77689370
complement(521)-t, cdbSNP:41557115
complement(523)-t, g, cdbSNP:1059615
complement(529)-g, cdbSNP:17885192
complement(532)-g, adbSNP:112201403
complement(538)-t, cdbSNP:2308764
complement(540)-t, cdbSNP:74626234
complement(546)-g, adbSNP:2308765
complement(549)-t, cdbSNP:112796209
complement(555)-g, cdbSNP:16822698
complement(560)-t, cdbSNP:202047044
complement(579)-t, c, adbSNP:78466762
complement(583)-t, cdbSNP:35363435
complement(585)-t, g, adbSNP:707954
complement(589)-t, cdbSNP:2308767
complement(599)-g, adbSNP:78916069
complement(604..606)-, atcdbSNP:199824918
complement(605)-g, adbSNP:701829
complement(607)-t, gdbSNP:63548860
complement(611)-g, adbSNP:2308769
complement(616)-t, cdbSNP:78767604
complement(622)-g, adbSNP:2308770
complement(625)-g, adbSNP:17850461
complement(628)-g, cdbSNP:77637983
complement(634)-g, cdbSNP:2308771
complement(637)-t, cdbSNP:74867190
complement(643)-t, cdbSNP:62930562
complement(652)-t, gdbSNP:113663708
complement(656)-t, cdbSNP:112116022
complement(664)-g, adbSNP:16822692
complement(676..677)-, tdbSNP:67077836
complement(678)-g, adbSNP:3205588
complement(679)-g, adbSNP:16822974
complement(681)-t, cdbSNP:35300013
complement(681)-, cdbSNP:67687262
complement(684)-g, c, adbSNP:2308775
complement(685)-g, adbSNP:701831
complement(687..706)-, cacttggcaggtgtaaacctdbSNP:140357311
complement(688)-g, adbSNP:16822972
complement(694)-g, adbSNP:2308777
complement(697)-t, cdbSNP:17405325
complement(700)-g, adbSNP:34938122
complement(704)-g, cdbSNP:36044702
complement(712)-g, adbSNP:34295373
complement(718)-g, adbSNP:199704140
complement(719)-t, g, cdbSNP:111739605
complement(721)-g, adbSNP:1059705
complement(723)-g, adbSNP:200809587
complement(724)-t, g, c, adbSNP:28732329
complement(725)-t, g, cdbSNP:33926824
complement(728)-g, cdbSNP:1136846
complement(729)-t, g, c, adbSNP:17885501
complement(730)-g, adbSNP:1071837
complement(733..734)-, cadbSNP:68086438
complement(734..735)-, cadbSNP:35837054
complement(736)-t, cdbSNP:111403823
complement(740)-g, cdbSNP:33936261
complement(748)-dbSNP:
complement(748)-t, adbSNP:1136881
complement(748)-t, adbSNP:78817721
complement(752)-g, adbSNP:34624872
complement(753)-t, cdbSNP:17856290
complement(799)-t, cdbSNP:707784
complement(799)-g, adbSNP:113175445
complement(800)-t, cdbSNP:201698383
complement(824)-g, adbSNP:3830125
complement(826)-c, adbSNP:3830126
complement(830)-t, cdbSNP:1059362
complement(832)-g, adbSNP:1059808
complement(835)-g, adbSNP:201168487
complement(836)-t, gdbSNP:199873800
complement(846)-t, cdbSNP:71547382
complement(871)-t, cdbSNP:35067512
complement(873)-c, adbSNP:17887154
complement(874)-t, cdbSNP:192487435
complement(879)-g, cdbSNP:9269744
complement(884)-dbSNP:
complement(884)-g, adbSNP:35445101
complement(887)-g, adbSNP:34475960
complement(897)-t, g, cdbSNP:9269693
complement(900)-t, gdbSNP:34955866
complement(907..908)-, gdbSNP:9279724
complement(908)-t, gdbSNP:201099263
complement(908)-, gdbSNP:68069105
complement(909..910)-, gdbSNP:41285181
complement(910)-, gdbSNP:71822874
complement(914)-t, cdbSNP:1059920
complement(917)-g, adbSNP:1064691
complement(920)-t, cdbSNP:202053852
complement(921)-t, cdbSNP:201375698
complement(924)-t, cdbSNP:1064692
complement(925)-t, cdbSNP:1064694
complement(927)-t, adbSNP:200538592
complement(930)-t, gdbSNP:1064695
complement(931)-t, cdbSNP:36217728
complement(935)-g, adbSNP:1064697
complement(939)-g, adbSNP:200849525
complement(942)-t, gdbSNP:146292738
complement(944)-t, cdbSNP:35324556
complement(945)-g, adbSNP:36217730
complement(952)-t, gdbSNP:35236441
complement(953)-t, cdbSNP:35521457
complement(956..957)-, adbSNP:71810699
complement(957)-t, cdbSNP:1064699
complement(958)-t, g, cdbSNP:12363
complement(960)-t, cdbSNP:3180268
complement(961)-t, g, c, adbSNP:3180799
complement(963)-g, adbSNP:9269688
complement(964)-, adbSNP:71864678
complement(968)-t, adbSNP:1064701
complement(969)-g, cdbSNP:1141869
complement(971)-t, cdbSNP:3200898
complement(980)-t, cdbSNP:182030800
complement(981)-g, adbSNP:116358897
complement(982)-g, adbSNP:1060081
complement(986)-g, adbSNP:3205692
complement(988..989)-, cctcdbSNP:34896825
complement(989)-t, cdbSNP:34844328
complement(990)-g, cdbSNP:36084494
complement(995)-g, cdbSNP:34007709
complement(998)-t, g, adbSNP:34022924
complement(1002)-g, adbSNP:113734598
complement(1004)-t, adbSNP:35463048
complement(1005)-g, adbSNP:1060129
complement(1010)-g, adbSNP:34009233
complement(1020)-t, g, adbSNP:1064707
complement(1023..1024)-, gcdbSNP:34160410
complement(1024..1025)-, agdbSNP:35165835
complement(1024)-t, g, adbSNP:3200044
complement(1026..1027)-, agdbSNP:148582499
complement(1036)-t, cdbSNP:112871130
complement(1037)-g, adbSNP:142078339
complement(1052)-c, adbSNP:1732
complement(1056)-g, adbSNP:35716402
complement(1059)-t, cdbSNP:1060176
complement(1060)-g, adbSNP:113804375
complement(1062)-g, cdbSNP:35000099
complement(1064)-g, adbSNP:3200047
complement(1065)-t, cdbSNP:1064709
complement(1066)-t, cdbSNP:1064710
complement(1067)-t, cdbSNP:3208409
complement(1079)-t, cdbSNP:1060185
complement(1080..1081)-, t, tgdbSNP:66798450
complement(1081..1082)-, ggdbSNP:35306263
complement(1081..1082)-, g, tgdbSNP:9281863
complement(1081)-t, gdbSNP:35195677
complement(1082..1083)-, tgdbSNP:71685135
complement(1085..1086)-, tgdbSNP:113493811
complement(1086)-t, adbSNP:1060190
complement(1089)-t, cdbSNP:1730
complement(1090)-g, adbSNP:1064712
complement(1093)-g, adbSNP:34981130
complement(1097)-t, cdbSNP:1064713
complement(1098)-g, c, adbSNP:3201069
complement(1107..1108)-, gdbSNP:34205910
complement(1108..1109)-, gdbSNP:199703384
complement(1109)-t, gdbSNP:80136018
complement(1111)-g, cdbSNP:34542752
complement(1121)-g, adbSNP:35263976
complement(1126..1127)-, adbSNP:71660512
complement(1128)-g, adbSNP:3201080
complement(1132)-t, cdbSNP:118126743
complement(1134)-t, g, adbSNP:1729
complement(1135)-g, cdbSNP:34215479
complement(1136)-g, adbSNP:34900518
complement(1137)-t, g, cdbSNP:1064715
complement(1139)-t, gdbSNP:34923246
complement(1140)-g, adbSNP:35418460
complement(1141)-c, adbSNP:6920823
complement(1144)-t, gdbSNP:185448040
complement(1147..1154)-, atgcacggdbSNP:200428856
complement(1148)-t, cdbSNP:1064717
complement(1149)-g, adbSNP:3205684
complement(1160)-t, cdbSNP:1060270
complement(1162..1163)-, tdbSNP:35078527
complement(1163)-t, gdbSNP:35513414
complement(1164)-g, adbSNP:35413567
complement(1165)-g, cdbSNP:36042073
complement(1167..1168)-, cdbSNP:35993567
complement(1170)-t, cdbSNP:35705303
complement(1171..1172)-gg, cadbSNP:71535483
complement(1171)-t, cdbSNP:1141883
complement(1172)-g, cdbSNP:3208365
complement(1173)-t, gdbSNP:34266013
complement(1176..1177)-, ttdbSNP:35136435
complement(1184)-t, cdbSNP:35297326
complement(1204)-t, gdbSNP:114103896
complement(1206)-g, cdbSNP:34839759
Gene SymbolHLA-DRB1
Gene SynonymDRB1; DRw10; HLA-DR1B; HLA-DRB; SS1
Chromosome6
Locus Map6p21.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001243965 Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), transcript variant 2, mRNA. In-stock $348.00 $299.00 10
NM_002124 Homo sapiens major histocompatibility complex, class II, DR beta 1 (HLA-DRB1), transcript variant 1, mRNA. In-stock $348.00 $299.00 10
Title T cell epitope mapping of JC polyoma virus-encoded proteome reveals reduced T cell responses in HLA-DRB1*04:01+ donors .
Author Jelcic,I., Aly,L., Binder,T.M., Jelcic,I., Bofill-Mas,S., Planas,R., Demina,V., Eiermann,T.H., Weber,T., Girones,R., Sospedra,M. and Martin,R.
Journal J. Virol. 87 (6), 3393-3408 (2013)
Title Anti-IFN-gamma autoantibodies in adults with disseminated nontuberculous mycobacterial infections are associated with HLA-DRB1*16:02 and HLA-DQB1*05:02 and the reactivation of latent varicella-zoster virus infection .
Author Chi,C.Y., Chu,C.C., Liu,J.P., Lin,C.H., Ho,M.W., Lo,W.J., Lin,P.C., Chen,H.J., Chou,C.H., Feng,J.Y., Fung,C.P., Sher,Y.P., Li,C.Y., Wang,J.H. and Ku,C.L.
Journal Blood 121 (8), 1357-1366 (2013)
Title Associations between HLA-DRB1*0102, HLA-B*5801, and hepatotoxicity during initiation of nevirapine-containing regimens in South Africa .
Author Phillips,E., Bartlett,J.A., Sanne,I., Lederman,M.M., Hinkle,J., Rousseau,F., Dunn,D., Pavlos,R., James,I., Mallal,S.A. and Haas,D.W.
Journal J. Acquir. Immune Defic. Syndr. 62 (2), E55-E57 (2013)
Title Common variants in the HLA-DRB1-HLA-DQA1 HLA class II region are associated with susceptibility to visceral leishmaniasis .
Author Fakiola,M., Strange,A., Cordell,H.J., Miller,E.N., Pirinen,M., Su,Z., Mishra,A., Mehrotra,S., Monteiro,G.R., Band,G., Bellenguez,C., Dronov,S., Edkins,S., Freeman,C., Giannoulatou,E., Gray,E., Hunt,S.E., Lacerda,H.G., Langford,C., Pearson,R., Pontes,N.N., Rai,M., Singh,S.P., Smith,L., Sousa,O., Vukcevic,D., Bramon,E., Brown,M.A., Casas,J.P., Corvin,A., Duncanson,A., Jankowski,J., Markus,H.S., Mathew,C.G., Palmer,C.N., Plomin,R., Rautanen,A., Sawcer,S.J., Trembath,R.C., Viswanathan,A.C., Wood,N.W., Wilson,M.E., Deloukas,P., Peltonen,L., Christiansen,F., Witt,C., Jeronimo,S.M., Sundar,S., Spencer,C.C., Blackwell,J.M. and Donnelly,P.
Journal Nat. Genet. 45 (2), 208-213 (2013)
Title Crystal structure of the HLA-DM-HLA-DR1 complex defines mechanisms for rapid peptide selection .
Author Pos,W., Sethi,D.K., Call,M.J., Schulze,M.S., Anders,A.K., Pyrdol,J. and Wucherpfennig,K.W.
Journal Cell 151 (7), 1557-1568 (2012)
Title HLA-DRB1 first domain sequence for a novel DR4 allele designated DRB1*0413 .
Author Petersdorf,E.W., Smith,A.G., Martin,P.J. and Hansen,J.A.
Journal Tissue Antigens 40 (5), 267-268 (1992)
Title Molecular analysis of HLA-DRB1*08/12 alleles: identification of two additional alleles .
Author Eberle,M. and Baxter-Lowe,L.A.
Journal Hum. Immunol. 34 (1), 24-30 (1992)
Title Molecular genetic analysis of HLA-DR and HLA-DQ genes among anti-U1-70-kd autoantibody positive connective tissue disease patients .
Author Kaneoka,H., Hsu,K.C., Takeda,Y., Sharp,G.C. and Hoffman,R.W.
Journal Arthritis Rheum. 35 (1), 83-94 (1992)
Title The evolutionary origin of the HLA-DR3 haplotype .
Author Vincek,V., Klein,D., Figueroa,F., Hauptfeld,V., Kasahara,M., O'hUigin,C., Mach,B. and Klein,J.
Journal Immunogenetics 35 (4), 263-271 (1992)
Title Mhc-DRB diversity of the chimpanzee (Pan troglodytes) .
Author Kenter,M., Otting,N., Anholts,J., Jonker,M., Schipper,R. and Bontrop,R.E.
Journal Immunogenetics 37 (1), 1-11 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.