• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 7 receptor (IL7R), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu39322 Homo sapiens interleukin 7 receptor (IL7R), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu39322C Homo sapiens interleukin 7 receptor (IL7R), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002185.3, 391224479
Length 1380 bp
Structure linear
Update Date 17-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 7 receptor (IL7R), transcript variant 1, mRNA.
Product interleukin-7 receptor subunit alpha precursor
Comment

Summary: The protein encoded by this gene is a receptor for interleukine 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukine 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in the V(D)J recombination during lymphocyte development. This protein is also found to control the accessibility of the TCR gamma locus by STAT5 and histone acetylation. Knockout studies in mice suggested that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. The functional defects in this protein may be associated with the pathogenesis of the severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2014].


Transcript Variant: This variant (1) encodes a functional protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002176.2
CDS 104..1483
Misc Feature(1)<608..787
Misc Feature(2)order(692..694,749..751)
Misc Feature(3)752..766
Misc Feature(4)order(752..757,761..766)
Misc Feature(5)821..895
Misc Feature(6)917..943
Misc Feature(7)1448..1450
Exon (1)1..185
Gene:IL7R
Gene Synonym:CD127; CDW127; IL-7R-alpha; IL7RA; ILRA
Exon (2)186..324
Gene:IL7R
Gene Synonym:CD127; CDW127; IL-7R-alpha; IL7RA; ILRA
Exon (3)325..482
Gene:IL7R
Gene Synonym:CD127; CDW127; IL-7R-alpha; IL7RA; ILRA
Exon (4)483..640
Gene:IL7R
Gene Synonym:CD127; CDW127; IL-7R-alpha; IL7RA; ILRA
Exon (5)641..809
Gene:IL7R
Gene Synonym:CD127; CDW127; IL-7R-alpha; IL7RA; ILRA
Exon (6)810..903
Gene:IL7R
Gene Synonym:CD127; CDW127; IL-7R-alpha; IL7RA; ILRA
Exon (7)904..979
Gene:IL7R
Gene Synonym:CD127; CDW127; IL-7R-alpha; IL7RA; ILRA
Exon (8)980..3819
Gene:IL7R
Gene Synonym:CD127; CDW127; IL-7R-alpha; IL7RA; ILRA
Translation MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE DPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKK IDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTH VNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES FGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
12+dbSNP:
12+c, tdbSNP:113268638
20+c, tdbSNP:200523830
65+c, tdbSNP:201511279
75+a, gdbSNP:200169985
87+c, tdbSNP:200201139
88+c, tdbSNP:369139531
92+a, gdbSNP:200964795
100+c, gdbSNP:202196214
105+g, tdbSNP:200076125
131+a, gdbSNP:145097494
154+c, tdbSNP:138981776
179+c, tdbSNP:202007062
190+dbSNP:
190+c, tdbSNP:370292681
200+a, gdbSNP:140673282
207+a, tdbSNP:35967524
231+a, gdbSNP:373694709
235+a, c, tdbSNP:11567704
238+g, tdbSNP:200464578
252+g, tdbSNP:202083738
255+c, tdbSNP:138482569
256+a, gdbSNP:149235072
271+c, tdbSNP:267600609
complement(300)-g, adbSNP:1494558
300+c, tdbSNP:386534380
315+a, tdbSNP:147423300
317+c, gdbSNP:148001159
335+dbSNP:
335+a, gdbSNP:200687605
342+c, tdbSNP:200475138
349+a, cdbSNP:201767916
368+c, tdbSNP:141698985
383..384+, atatatttcadbSNP:193922640
386+a, gdbSNP:191585195
409+a, tdbSNP:200241281
410+a, gdbSNP:201106853
416+a, cdbSNP:199742437
417+a, gdbSNP:150051812
418+c, tdbSNP:201058754
436+c, tdbSNP:199641706
439+a, gdbSNP:200817423
442+a, cdbSNP:11567735
456+a, gdbSNP:193922641
461+a, gdbSNP:200506624
462+a, tdbSNP:201710684
469+a, cdbSNP:140473900
476+a, gdbSNP:145407742
479+a, c, gdbSNP:201207454
497+dbSNP:
497+c, tdbSNP:104893894
507+g, tdbSNP:199779006
510+a, gdbSNP:201012821
complement(515)-t, cdbSNP:1494555
515+c, tdbSNP:386534379
522+a, gdbSNP:200373233
527+a, gdbSNP:200772681
530+a, gdbSNP:372676633
536+a, gdbSNP:201790329
545+c, gdbSNP:200332345
549+c, tdbSNP:201940568
559+a, c, gdbSNP:112805866
563+c, tdbSNP:199727195
569+c, tdbSNP:139221577
571+a, gdbSNP:112368558
584+a, gdbSNP:200233367
598+c, g, tdbSNP:2228141
604+a, tdbSNP:199697302
611+c, tdbSNP:145210284
612+a, gdbSNP:149161098
618+a, gdbSNP:199654814
622+a, gdbSNP:143661008
623+a, gdbSNP:375672744
631+a, cdbSNP:149833809
639+a, c, tdbSNP:200751605
642+dbSNP:
642+a, cdbSNP:193922642
643+c, tdbSNP:201040470
644+a, gdbSNP:62351970
664+a, gdbSNP:11567764
673+c, gdbSNP:200528373
694+a, gdbSNP:201431556
697+a, cdbSNP:191457074
705+a, gdbSNP:145810271
706+c, tdbSNP:200388101
719..720+cg, tadbSNP:193922643
719+c, tdbSNP:201559094
720+a, g, tdbSNP:193922644
747+g, tdbSNP:193922645
754+a, gdbSNP:104893893
756+a, gdbSNP:374232919
783+a, gdbSNP:148165103
786+c, tdbSNP:201412341
798+a, gdbSNP:199714011
804+c, gdbSNP:200894429
805+a, cdbSNP:201897242
810+dbSNP:
810+a, gdbSNP:201084372
812+a, gdbSNP:372056746
824+a, gdbSNP:141111406
834+c, tdbSNP:6897932
847+c, gdbSNP:200086692
862+c, tdbSNP:201268331
863+a, gdbSNP:137868226
868+a, gdbSNP:143438470
875+a, tdbSNP:200150755
881+a, gdbSNP:147153824
910+dbSNP:
910+a, gdbSNP:199814261
916+c, tdbSNP:200468194
917+a, gdbSNP:369971728
935+a, gdbSNP:201449880
948+c, tdbSNP:373309714
964+c, tdbSNP:375706394
985+dbSNP:
985+a, cdbSNP:193922647
1011+c, tdbSNP:200107390
1018+c, tdbSNP:200889239
1043+a, gdbSNP:202060571
1055+a, gdbSNP:200521932
1060+a, tdbSNP:201275186
1061+g, tdbSNP:202226690
1062+g, tdbSNP:140979277
1081+c, tdbSNP:370440024
1084+a, gdbSNP:200211847
1093+a, gdbSNP:201093124
1106+c, tdbSNP:199735993
1123+g, tdbSNP:138731184
1129+a, gdbSNP:201058934
1146+a, c, gdbSNP:41270321
1149+c, g, tdbSNP:200927791
1151+c, tdbSNP:111803690
1169+a, gdbSNP:3194051
1174+c, tdbSNP:142726694
1178+g, tdbSNP:1803814
1179+a, cdbSNP:200629583
1180+a, cdbSNP:201722571
1185+c, g, tdbSNP:200061456
1193+a, gdbSNP:149811361
1195+g, tdbSNP:201216012
1199+c, tdbSNP:201671392
1210+a, cdbSNP:199803084
1212+a, tdbSNP:374876660
1218+g, tdbSNP:201146815
1237+c, g, tdbSNP:150593442
1238+a, gdbSNP:200570812
1253+c, tdbSNP:200775167
1260+a, gdbSNP:201790771
1264+c, tdbSNP:139678300
1268+c, gdbSNP:143596606
1270+a, cdbSNP:201298914
1272+g, tdbSNP:370396298
1291+c, tdbSNP:145705481
1293+c, gdbSNP:200217234
1303+a, gdbSNP:140634356
1324+c, tdbSNP:267600610
1334+a, gdbSNP:115316501
1340+a, tdbSNP:368172701
1344+c, tdbSNP:2229232
1353+c, tdbSNP:201661275
1355+c, gdbSNP:199666194
1359+c, tdbSNP:149195024
1369+a, gdbSNP:201755068
1402+c, gdbSNP:200165388
1406+c, gdbSNP:371681482
1411+c, tdbSNP:368296149
1419+c, gdbSNP:148931962
1434+a, gdbSNP:151326413
1441+a, gdbSNP:112890868
1456+c, tdbSNP:201947153
1460+c, tdbSNP:141919625
1500+a, gdbSNP:201020485
1501+c, tdbSNP:377463049
1517+a, cdbSNP:201713518
1523+a, gdbSNP:199882238
1525+a, gdbSNP:145513117
1569+a, cdbSNP:202075594
1588+c, gdbSNP:200590959
1594+a, cdbSNP:138148579
1604+a, gdbSNP:202200371
1618+a, tdbSNP:112348735
1619+a, gdbSNP:200395973
1630+c, tdbSNP:201394819
1636+a, gdbSNP:199768633
1638+c, tdbSNP:190597330
1662+a, gdbSNP:140969613
1694+c, tdbSNP:199673589
1716+c, gdbSNP:144757435
1733+c, gdbSNP:201645441
1740..1741+, adbSNP:370775861
1740+, adbSNP:202167692
1771+a, gdbSNP:200036308
1783+a, cdbSNP:200526971
1805+a, gdbSNP:201512867
1815..1816+, gaaadbSNP:145416689
1815+a, gdbSNP:200134977
1816..1817+, aaag, gaaadbSNP:11567767
1823..1824+, agaadbSNP:140734994
1828..1829+, aaagdbSNP:397691511
1829+a, gdbSNP:200767455
1833+a, gdbSNP:202195454
1835+a, tdbSNP:200083526
1849+g, tdbSNP:201380627
1936+g, tdbSNP:79286909
1952+c, tdbSNP:369100388
1991+a, gdbSNP:74625608
2035+a, gdbSNP:148253481
2044+a, gdbSNP:181945634
2134+c, gdbSNP:77118170
2178+a, cdbSNP:11567768
2205+c, tdbSNP:370147033
2262+a, gdbSNP:374347576
2313+a, cdbSNP:11567769
2331+a, gdbSNP:141201259
2348+c, gdbSNP:184482643
2400+a, gdbSNP:10063294
2421+g, tdbSNP:189056705
2464+g, tdbSNP:150755607
2510+a, gdbSNP:374784603
2514+a, gdbSNP:181322631
2515+a, tdbSNP:374220579
2654+a, gdbSNP:16902514
2715+g, tdbSNP:80264384
2721+a, tdbSNP:9292617
2736+a, gdbSNP:386513532
complement(2736)-t, c, adbSNP:10491435
2745+c, gdbSNP:149458295
2769+c, gdbSNP:185636216
complement(2809)-t, cdbSNP:10491434
2939+g, tdbSNP:190735139
2989+c, tdbSNP:77732174
2991+c, gdbSNP:111740630
3027+a, gdbSNP:11567770
complement(3028)-g, cdbSNP:1494575
3035+a, gdbSNP:10053847
3035+a, gdbSNP:111176235
3061+a, gdbSNP:371321031
3102+g, tdbSNP:113174267
3144+a, gdbSNP:7716064
3185+a, cdbSNP:147528974
3326+a, tdbSNP:140174728
3384+, cdbSNP:33994244
3385+c, tdbSNP:187393408
3407+a, gdbSNP:9292618
3457+a, gdbSNP:145691961
3585+a, tdbSNP:147298536
3648+c, tdbSNP:76614394
3676+a, gdbSNP:16902521
3691+g, tdbSNP:114441625
3769+a, gdbSNP:377068522
3822+c, tdbSNP:6451231
3896+g, tdbSNP:192345351
3937+a, tdbSNP:6862072
3975+a, tdbSNP:183660202
3990+c, tdbSNP:6881270
4030+a, gdbSNP:13167136
4051+g, tdbSNP:6881706
4060+, cdbSNP:370147422
4111+a, gdbSNP:148781726
4218+c, tdbSNP:367670944
4233+c, gdbSNP:6885455
4253+a, gdbSNP:142305608
4280+a, gdbSNP:1132841
4284+a, cdbSNP:1132842
4300+a, cdbSNP:113393512
4324+a, c, g, tdbSNP:1053496
4356+c, tdbSNP:377053917
4381+a, gdbSNP:76863142
4478+a, c, gdbSNP:72742450
4490+a, c, g, tdbSNP:700179
4498+a, gdbSNP:1862632
4508+g, tdbSNP:374172302
4525+a, gdbSNP:151275799
4561+a, gdbSNP:1862633
4572+c, tdbSNP:187963551
Gene SymbolIL7R
Gene SynonymCD127; CDW127; IL-7R-alpha; IL7RA; ILRA
Chromosome5
Locus Map5p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002185 Homo sapiens interleukin 7 receptor (IL7R), transcript variant 1, mRNA. On-demand $219.00 7-9
XM_005248299 PREDICTED: Homo sapiens interleukin 7 receptor (IL7R), transcript variant X1, mRNA. On-demand $159.00 7-9
XM_005248300 PREDICTED: Homo sapiens interleukin 7 receptor (IL7R), transcript variant X2, mRNA. On-demand $159.00 7-9
Title Downregulation of IL7R, CCR7, and TLR4 in the cord blood of children with respiratory syncytial virus disease .
Author Inchley CS, Osterholt HC, Sonerud T, Fjaerli HO and Nakstad B.
Journal J. Infect. Dis. 208 (9), 1431-1435 (2013)
Title Chimeric gammac cytokine receptors confer cytokine independent engraftment of human T lymphocytes .
Author Hunter MR, Prosser ME, Mahadev V, Wang X, Aguilar B, Brown CE, Forman SJ and Jensen MC.
Journal Mol. Immunol. 56 (1-2), 1-11 (2013)
Title Impaired thymic output in patients with chronic hepatitis C virus infection .
Author Hartling HJ, Gaardbo JC, Ronit A, Salem M, Laye M, Clausen MR, Skogstrand K, Gerstoft J, Ullum H and Nielsen SD.
Journal Scand. J. Immunol. 78 (4), 378-386 (2013)
Title Polymorphism in the interleukin-7 receptor-alpha and outcome after allogeneic hematopoietic cell transplantation with matched unrelated donor .
Author Shamim Z, Spellman S, Haagenson M, Wang T, Lee SJ, Ryder LP and Muller K.
Journal Scand. J. Immunol. 78 (2), 214-220 (2013)
Title HIV immune activation drives increased Eomes expression in memory CD8 T cells in association with transcriptional downregulation of CD127 .
Author Hasley RB, Hong C, Li W, Friesen T, Nakamura Y, Kim GY, Park JH, Hixon JA, Durum S, Hu Z, Sneller MC, Oguariri R, Imamichi T, Lane
Journal AIDS 27 (12), 1867-1877 (2013)
Title Activation of src family kinases in human pre-B cells by IL-7 .
Author Seckinger P and Fougereau M.
Journal J. Immunol. 153 (1), 97-109 (1994)
Title The interleukin-7 receptor gene is at 5p13 .
Author Lynch M, Baker E, Park LS, Sutherland GR and Goodwin RG.
Journal Hum. Genet. 89 (5), 566-568 (1992)
Title c-kit gene expression in CD7-positive acute lymphoblastic leukemia: close correlation with expression of myeloid-associated antigen CD13 .
Author Nishii K, Kita K, Miwa H, Kawakami K, Nakase K, Masuya M, Morita N, Omay SB, Otsuji N and Fukumoto M.
Journal Leukemia 6 (7), 662-668 (1992)
Title Organization of the murine and human interleukin-7 receptor genes: two mRNAs generated by differential splicing and presence of a type I-interferon-inducible promoter .
Author Pleiman CM, Gimpel SD, Park LS, Harada H, Taniguchi T and Ziegler SF.
Journal Mol. Cell. Biol. 11 (6), 3052-3059 (1991)
Title Cloning of the human and murine interleukin-7 receptors: demonstration of a soluble form and homology to a new receptor superfamily .
Author Goodwin RG, Friend D, Ziegler SF, Jerzy R, Falk BA, Gimpel S, Cosman D, Dower SK, March CJ and Namen AE.
Journal Cell 60 (6), 941-951 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.