• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 12B (IL12B), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20878 Homo sapiens interleukin 12B (IL12B), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu20878C Homo sapiens interleukin 12B (IL12B), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002187.2, 24497437
Length 987 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 12B (IL12B), mRNA.
Product interleukin-12 subunit beta precursor
Comment

Summary: This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002178.2
CDS 43..1029
Misc Feature(1)166..312
Misc Feature(2)415..693
Misc Feature(3)745..1017
Misc Feature(4)order(745..747,985..987)
Misc Feature(5)order(988..993,997..1002)
Exon (1)43..130
Gene:IL12B
Gene Synonym:CLMF; CLMF2; IL-12B; NKSF; NKSF2
Exon (2)131..406
Gene:IL12B
Gene Synonym:CLMF; CLMF2; IL-12B; NKSF; NKSF2
Exon (3)407..524
Gene:IL12B
Gene Synonym:CLMF; CLMF2; IL-12B; NKSF; NKSF2
Exon (4)525..739
Gene:IL12B
Gene Synonym:CLMF; CLMF2; IL-12B; NKSF; NKSF2
Exon (5)740..897
Gene:IL12B
Gene Synonym:CLMF; CLMF2; IL-12B; NKSF; NKSF2
Exon (6)898..1029
Gene:IL12B
Gene Synonym:CLMF; CLMF2; IL-12B; NKSF; NKSF2
Exon (7)1030..2347
Gene:IL12B
Gene Synonym:CLMF; CLMF2; IL-12B; NKSF; NKSF2
Translation MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC RKNASISVRAQDRYYSSSWSEWASVPCS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(65)-dbSNP:
complement(65)-g, adbSNP:372473387
complement(78)-g, cdbSNP:139890370
139+dbSNP:
139+a, gdbSNP:3213096
complement(169)-t, cdbSNP:144020395
complement(188)-g, adbSNP:56347721
complement(197)-t, gdbSNP:140131034
complement(199)-g, adbSNP:183111978
complement(233)-t, cdbSNP:150659914
complement(250)-t, cdbSNP:201684769
complement(320)-t, cdbSNP:267600520
complement(324)-g, adbSNP:142017503
complement(325)-t, cdbSNP:56287471
complement(328)-c, adbSNP:368468349
complement(341)-g, adbSNP:144694601
complement(342)-t, cdbSNP:142998256
complement(343)-g, adbSNP:200722574
complement(389)-, adbSNP:11317523
complement(392)-t, adbSNP:375191855
complement(413)-dbSNP:
complement(413)-t, cdbSNP:199703726
complement(425)-c, adbSNP:183576218
complement(436)-t, cdbSNP:139186048
complement(477)-t, cdbSNP:56051849
complement(483)-t, gdbSNP:140642018
complement(487)-t, adbSNP:368021638
complement(491)-g, adbSNP:373631126
complement(526)-dbSNP:
complement(526)-g, adbSNP:56369079
complement(549)-c, adbSNP:369160771
complement(553)-t, cdbSNP:189313574
complement(578)-g, cdbSNP:375159171
complement(586)-t, cdbSNP:10045130
complement(597)-t, cdbSNP:142400793
complement(665)-g, adbSNP:138127918
complement(684)-g, adbSNP:149273360
complement(685)-t, cdbSNP:79446920
complement(711)-g, adbSNP:149027358
complement(719)-t, cdbSNP:55661460
complement(753)-dbSNP:
complement(753)-t, cdbSNP:199527043
complement(778)-g, adbSNP:372926766
complement(780)-t, cdbSNP:192540461
complement(790)-g, adbSNP:368458310
complement(791)-t, cdbSNP:74644143
complement(797)-c, adbSNP:201757381
complement(865)-t, cdbSNP:189324104
complement(871)-t, cdbSNP:372475701
complement(893)-t, cdbSNP:111492985
complement(902)-dbSNP:
complement(902)-t, cdbSNP:146408881
complement(905)-g, cdbSNP:370904274
complement(906)-t, cdbSNP:144054146
complement(912)-g, adbSNP:139163137
complement(914)-g, adbSNP:367828574
complement(915)-t, cdbSNP:144356274
complement(916)-c, adbSNP:150030340
complement(930)-g, cdbSNP:374523632
complement(932)-g, adbSNP:374661285
complement(933)-t, cdbSNP:186003445
complement(934)-t, gdbSNP:3213119
complement(939)-g, adbSNP:150902695
complement(944)-t, cdbSNP:377511395
complement(964)-c, adbSNP:373042362
complement(979)-g, adbSNP:371280399
complement(980)-t, cdbSNP:377524637
complement(1003)-t, cdbSNP:201512006
complement(1015)-t, cdbSNP:56064925
complement(1023)-t, gdbSNP:138991749
complement(1024)-t, gdbSNP:143277765
complement(1030)-dbSNP:
complement(1030)-g, adbSNP:3213120
complement(1143..1144)-, tdbSNP:3213112
complement(1143..1144)-, adbSNP:78509294
1144..1145+, tdbSNP:397840403
1188+a, cdbSNP:3212227
complement(1188)-t, gdbSNP:386580886
1217+a, cdbSNP:1805132
complement(1254)-c, adbSNP:3213113
complement(1258)-g, cdbSNP:55949756
complement(1259)-g, adbSNP:56396672
complement(1321)-g, adbSNP:186528423
1369+g, tdbSNP:41412344
complement(1437)-g, adbSNP:181215530
complement(1445)-g, adbSNP:188784749
complement(1549)-t, cdbSNP:3213114
complement(1559)-g, adbSNP:139879928
complement(1587)-t, gdbSNP:146117745
complement(1713)-, tdbSNP:56390703
complement(1717)-t, adbSNP:144366632
complement(1725)-g, cdbSNP:369157824
complement(1728)-t, cdbSNP:139698981
1745+a, cdbSNP:41454346
complement(1748)-t, cdbSNP:376593057
1775+c, tdbSNP:41292468
complement(1912)-t, gdbSNP:56409614
complement(1930)-, tdbSNP:34324765
complement(1960)-g, adbSNP:55876812
complement(2009)-t, gdbSNP:185933681
complement(2020)-, adbSNP:56081148
complement(2124)-t, gdbSNP:1368439
complement(2168)-g, adbSNP:369997793
complement(2215)-c, adbSNP:181807125
complement(2251)-g, adbSNP:144817848
Gene SymbolIL12B
Gene SynonymCLMF; CLMF2; IL-12B; NKSF; NKSF2
Chromosome5
Locus Map5q31.1-q33.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002187 Homo sapiens interleukin 12B (IL12B), mRNA. In-stock $99.00 5-7
Title Novel function for the p38-MK2 signaling pathway in circulating CD1c+ (BDCA-1+) myeloid dendritic cells from healthy donors and advanced cancer patients; inhibition of p38 enhances IL-12 whilst suppressing IL-10 .
Author Franks HA, Wang Q, Lax SJ, Collins MK, Escors D, Patel PM and Jackson AM.
Journal Int. J. Cancer 134 (3), 575-586 (2014)
Title A 1,100-year-old founder effect mutation in IL12B gene is responsible for Mendelian susceptibility to mycobacterial disease in Tunisian patients .
Author Ben-Mustapha I, Ben-Ali M, Mekki N, Patin E, Harmant C, Bouguila J, Elloumi-Zghal H, Harbi A, Bejaoui M, Boughammoura L, Chemli J and Barbouche MR.
Journal Immunogenetics 66 (1), 67-71 (2014)
Title IL12B and IL23R gene SNPs in Japanese psoriasis .
Author Oka A, Mabuchi T, Ikeda S, Terui T, Haida Y, Ozawa A, Yatsu K, Kulski JK and Inoko H.
Journal Immunogenetics 65 (11), 823-828 (2013)
Title Association of interleukin-12 polymorphisms and serum IL-12p40 levels with osteosarcoma risk .
Author Wang J, Nong L, Wei Y, Qin S, Zhou Y and Tang Y.
Journal DNA Cell Biol. 32 (10), 605-610 (2013)
Title Polymorphisms of the IL12B, IL1B, and TNFA genes and susceptibility to asthma .
Author Padron-Morales,J., Sanz,C., Davila,I., Munoz-Bellido,F., Lorente,F. and Isidoro-Garcia,M.
Journal J Investig Allergol Clin Immunol 23 (7), 487-494 (2013)
Title Assignment of genes encoding a unique cytokine (IL12) composed of two unrelated subunits to chromosomes 3 and 5 .
Author Sieburth D, Jabs EW, Warrington JA, Li X, Lasota J, LaForgia S, Kelleher K, Huebner K, Wasmuth JJ and Wolf SF.
Journal Genomics 14 (1), 59-62 (1992)
Title Homology of the p40 subunit of natural killer cell stimulatory factor (NKSF) with the extracellular domain of the interleukin-6 receptor .
Author Gearing,D.P. and Cosman,D.
Journal Cell 66 (1), 9-10 (1991)
Title Coexpression of two distinct genes is required to generate secreted bioactive cytotoxic lymphocyte maturation factor .
Author Gubler U, Chua AO, Schoenhaut DS, Dwyer CM, McComas W, Motyka R, Nabavi N, Wolitzky AG, Quinn PM and Familletti PC.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (10), 4143-4147 (1991)
Title Cloning of cDNA for natural killer cell stimulatory factor, a heterodimeric cytokine with multiple biologic effects on T and natural killer cells .
Author Wolf SF, Temple PA, Kobayashi M, Young D, Dicig M, Lowe L, Dzialo R, Fitz L, Ferenz C and Hewick RM.
Journal J. Immunol. 146 (9), 3074-3081 (1991)
Title Purification to homogeneity and partial characterization of cytotoxic lymphocyte maturation factor from human B-lymphoblastoid cells .
Author Stern AS, Podlaski FJ, Hulmes JD, Pan YC, Quinn PM, Wolitzky AG, Familletti PC, Stremlo DL, Truitt T and Chizzonite R.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (17), 6808-6812 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.