• THAT   AND
  • THAT   AND


Homo sapiens interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) (IL12B), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002187 Homo sapiens interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) (IL12B), mRNA. Full Lenth $680.63
ORF Sequence $286.23


RefSeq Version NM_002187.2, 24497437
Length 2347 bp
Structure linear
Update Date 02-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) (IL12B), mRNA.
Product interleukin-12 subunit beta precursor
Comment

Summary: This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children. [provided by RefSeq].

RefSeq NP_002178.2
CDS 43..1029
Exon (1)1..42
Exon (2)43..130
Exon (3)131..406
Exon (4)407..524
Exon (5)525..739
Exon (6)740..897
Exon (7)898..1029
Exon (8)1030..2347
Translation MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC RKNASISVRAQDRYYSSSWSEWASVPCS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
139+a, gdbSNP:3213096
complement(188)-g, adbSNP:56347721
complement(325)-t, cdbSNP:56287471
complement(389)-, adbSNP:11317523
complement(477)-t, cdbSNP:56051849
complement(526)-g, adbSNP:56369079
complement(586)-t, cdbSNP:10045130
complement(685)-t, cdbSNP:79446920
complement(719)-t, cdbSNP:55661460
complement(791)-t, cdbSNP:74644143
complement(893)-t, cdbSNP:111492985
934+g, tdbSNP:3213119
complement(1015)-t, cdbSNP:56064925
1030+a, gdbSNP:3213120
1143..1144+, tdbSNP:3213112
complement(1143)-, adbSNP:78509294
1144..1145+, tdbSNP:3219202
1188+a, cdbSNP:3212227
1217+a, cdbSNP:1805132
1254+a, cdbSNP:3213113
complement(1258)-g, cdbSNP:55949756
complement(1259)-g, adbSNP:56396672
1369+g, tdbSNP:41412344
1549+c, tdbSNP:3213114
complement(1713)-, tdbSNP:56390703
1745+a, cdbSNP:41454346
1775+c, tdbSNP:41292468
complement(1912)-t, gdbSNP:56409614
complement(1920)-, tdbSNP:34324765
complement(1930)-, tdbSNP:71577370
complement(1960)-g, adbSNP:55876812
complement(2020)-, adbSNP:56081148
complement(2124)-t, gdbSNP:1368439
complement(2307)-c, adbSNP:77528905
Gene SymbolIL12B
Gene SynonymCLMF; CLMF2; IL-12B; NKSF; NKSF2
Chromosome5
Locus Map5q31.1-q33.1
All Transcripts NM_002187
Title Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47 .
Author Anderson,C.A., Boucher,G., Lees,C.W., Franke,A., D'Amato,M., Taylor,K.D., Lee,J.C., Goyette,P., Imielinski,M., Latiano,A., Lagace,C., Scott,R., Amininejad,L., Bumpstead,S., Baidoo,L., Baldassano,R.N., Barclay,M., Bayless,T.M., Brand,S., Buning,C., Colombel,J.F., Denson,L.A., De Vos,M., Dubinsky,M., Edwards,C., Ellinghaus,D., Fehrmann,R.S., Floyd,J.A., Florin,T., Franchimont,D., Franke,L., Georges,M., Glas,J., Glazer,N.L., Guthery,S.L., Haritunians,T., Hayward,N.K., Hugot,J.P., Jobin,G., Laukens,D., Lawrance,I., Lemann,M., Levine,A., Libioulle,C., Louis,E., McGovern,D.P., Milla,M., Montgomery,G.W., Morley,K.I., Mowat,C., Ng,A., Newman,W., Ophoff,R.A., Papi,L., Palmieri,O., Peyrin-Biroulet,L., Panes,J., Phillips,A., Prescott,N.J., Proctor,D.D., Roberts,R., Russell,R., Rutgeerts,P., Sanderson,J., Sans,M., Schumm,P., Seibold,F., Sharma,Y., Simms,L.A., Seielstad,M., Steinhart,A.H., Targan,S.R., van den Berg,L.H., Vatn,M., Verspaget,H., Walters,T., Wijmenga,C., Wilson,D.C., Westra,H.J., Xavier,R.J., Zhao,Z.Z., Ponsioen,C.Y., Andersen,V., Torkvist,L., Gazouli,M., Anagnou,N.P., Karlsen,T.H., Kupcinskas,L., Sventoraityte,J., Mansfield,J.C., Kugathasan,S., Silverberg,M.S., Halfvarson,J., Rotter,J.I., Mathew,C.G., Griffiths,A.M., Gearry,R., Ahmad,T., Brant,S.R., Chamaillard,M., Satsangi,J., Cho,J.H., Schreiber,S., Daly,M.J., Barrett,J.C., Parkes,M., Annese,V., Hakonarson,H., Radford-Smith,G., Duerr,R.H., Vermeire,S., Weersma,R.K. and Rioux,J.D.
Journal Nat. Genet. 43 (3), 246-252 (2011)
Title Induction of immunostimulatory cytokine genes expression in human PBMCs by a novel semiquinone glucoside derivative (SQGD) isolated from a Bacillus sp. INM-1 .
Author Kumar,R., Sharma,R.K., Bansal,D.D., Patel,D.D., Mishra,S., Miteva,L., Dobreva,Z., Gadjeva,V. and Stanilova,S.
Journal Cell. Immunol. 267 (1), 67-75 (2011)
Title Human breast tumor cells express IL-10 and IL-12p40 transcripts and proteins, but do not produce IL-12p70 .
Author Heckel,M.C., Wolfson,A., Slachta,C.A., Schwarting,R., Salgame,P., Katsetos,C.D. and Platsoucas,C.D.
Journal Cell. Immunol. 266 (2), 143-153 (2011)
Title A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1 .
Author Strange,A., Capon,F., Spencer,C.C., Knight,J., Weale,M.E., Allen,M.H., Barton,A., Band,G., Bellenguez,C., Bergboer,J.G., Blackwell,J.M., Bramon,E., Bumpstead,S.J., Casas,J.P., Cork,M.J., Corvin,A., Deloukas,P., Dilthey,A., Duncanson,A., Edkins,S., Estivill,X., Fitzgerald,O., Freeman,C., Giardina,E., Gray,E., Hofer,A., Huffmeier,U., Hunt,S.E., Irvine,A.D., Jankowski,J., Kirby,B., Langford,C., Lascorz,J., Leman,J., Leslie,S., Mallbris,L., Markus,H.S., Mathew,C.G., McLean,W.H., McManus,R., Mossner,R., Moutsianas,L., Naluai,A.T., Nestle,F.O., Novelli,G., Onoufriadis,A., Palmer,C.N., Perricone,C., Pirinen,M., Plomin,R., Potter,S.C., Pujol,R.M., Rautanen,A., Riveira-Munoz,E., Ryan,A.W., Salmhofer,W., Samuelsson,L., Sawcer,S.J., Schalkwijk,J., Smith,C.H., Stahle,M., Su,Z., Tazi-Ahnini,R., Traupe,H., Viswanathan,A.C., Warren,R.B., Weger,W., Wolk,K., Wood,N., Worthington,J., Young,H.S., Zeeuwen,P.L., Hayday,A., Burden,A.D., Griffiths,C.E., Kere,J., Reis,A., McVean,G., Evans,D.M., Brown,M.A., Barker,J.N., Peltonen,L., Donnelly,P. and Trembath,R.C.
Journal Nat. Genet. 42 (11), 985-990 (2010)
Title Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis .
Author Laukens,D., Georges,M., Libioulle,C., Sandor,C., Mni,M., Vander Cruyssen,B., Peeters,H., Elewaut,D. and De Vos,M.
Journal PLoS ONE 5 (11), E13795 (2010)
Title Assignment of genes encoding a unique cytokine (IL12) composed of two unrelated subunits to chromosomes 3 and 5 .
Author Sieburth,D., Jabs,E.W., Warrington,J.A., Li,X., Lasota,J., LaForgia,S., Kelleher,K., Huebner,K., Wasmuth,J.J. and Wolf,S.F.
Journal Genomics 14 (1), 59-62 (1992)
Title Homology of the p40 subunit of natural killer cell stimulatory factor (NKSF) with the extracellular domain of the interleukin-6 receptor .
Author Gearing,D.P. and Cosman,D.
Journal Cell 66 (1), 9-10 (1991)
Title Coexpression of two distinct genes is required to generate secreted bioactive cytotoxic lymphocyte maturation factor .
Author Gubler,U., Chua,A.O., Schoenhaut,D.S., Dwyer,C.M., McComas,W., Motyka,R., Nabavi,N., Wolitzky,A.G., Quinn,P.M., Familletti,P.C. et al.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (10), 4143-4147 (1991)
Title Cloning of cDNA for natural killer cell stimulatory factor, a heterodimeric cytokine with multiple biologic effects on T and natural killer cells .
Author Wolf,S.F., Temple,P.A., Kobayashi,M., Young,D., Dicig,M., Lowe,L., Dzialo,R., Fitz,L., Ferenz,C., Hewick,R.M. et al.
Journal J. Immunol. 146 (9), 3074-3081 (1991)
Title Purification to homogeneity and partial characterization of cytotoxic lymphocyte maturation factor from human B-lymphoblastoid cells .
Author Stern,A.S., Podlaski,F.J., Hulmes,J.D., Pan,Y.C., Quinn,P.M., Wolitzky,A.G., Familletti,P.C., Stremlo,D.L., Truitt,T., Chizzonite,R. et al.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (17), 6808-6812 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878