• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 13 (IL13), mRNA.


RefSeq Accession Definition Services Price Order
NM_002188 Homo sapiens interleukin 13 (IL13), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002188.2, 26787977
Length 1282 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 13 (IL13), mRNA.
Product interleukin-13 precursor
Comment

Summary: This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq, Jul 2008].

RefSeq NP_002179.2
CDS 15..455
Misc Feature(1)72..449
Misc Feature(2)57..59
Exon (1)189..242
Gene:IL13
Gene Synonym:ALRH; BHR1; IL-13; P600
Exon (2)243..347
Gene:IL13
Gene Synonym:ALRH; BHR1; IL-13; P600
Exon (3)348..1282
Gene:IL13
Gene Synonym:ALRH; BHR1; IL-13; P600
Translation MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP LCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD TKIEVAQFVKDLLLHLKKLFREGQFN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
3+dbSNP:
3+c, gdbSNP:76471112
6+a, cdbSNP:202009492
22+c, tdbSNP:200168712
34+a, cdbSNP:201121980
48+c, tdbSNP:202050622
62+a, gdbSNP:199924106
69+c, tdbSNP:201053365
74+c, tdbSNP:55733734
76+c, tdbSNP:78181870
89+c, gdbSNP:200186367
101+c, tdbSNP:201424420
116+a, gdbSNP:202220644
122+c, tdbSNP:200638839
139+a, cdbSNP:200571678
143+c, tdbSNP:202011628
149+c, gdbSNP:56035208
167+g, tdbSNP:34255686
190+dbSNP:
190+c, tdbSNP:138680496
193+c, tdbSNP:146770163
194+a, gdbSNP:140369292
204+a, gdbSNP:199869056
216+c, tdbSNP:143660447
229+c, tdbSNP:148077750
234+g, tdbSNP:200120288
248+dbSNP:
248+c, tdbSNP:192837804
250+g, tdbSNP:34654684
254+c, tdbSNP:150226731
266+c, gdbSNP:200913948
272+c, tdbSNP:201716976
274+g, tdbSNP:199513811
312+c, gdbSNP:200793410
328+c, tdbSNP:201804555
329+a, gdbSNP:200113399
364+dbSNP:
364+a, gdbSNP:184944562
370+a, gdbSNP:140828306
383+c, tdbSNP:78628956
387+a, gdbSNP:140196099
404+a, gdbSNP:201624646
407+a, cdbSNP:200380202
435+c, tdbSNP:201475069
437+c, tdbSNP:199797009
440+c, g, tdbSNP:200247901
445+c, tdbSNP:20541
451+a, cdbSNP:56258826
492+c, tdbSNP:2069749
498+c, tdbSNP:56318025
506+a, gdbSNP:75868517
510+a, gdbSNP:201863406
542+g, tdbSNP:199516826
551+a, gdbSNP:200797041
609+c, tdbSNP:201802470
610+a, gdbSNP:200196698
615+c, tdbSNP:200786939
675+c, tdbSNP:201490660
677+a, gdbSNP:199955551
690+c, tdbSNP:200895460
696+a, gdbSNP:202233186
711+a, gdbSNP:190222211
717+a, gdbSNP:150177673
750+a, tdbSNP:201185816
752+c, tdbSNP:202101165
755+a, gdbSNP:200632360
770+a, tdbSNP:115325936
778..779+, atdbSNP:149809253
792+c, gdbSNP:199511991
793+c, gdbSNP:200265585
803+a, cdbSNP:201420607
822+a, cdbSNP:199804866
841+c, gdbSNP:200650844
844+c, tdbSNP:201965069
893+c, tdbSNP:181825588
897+a, gdbSNP:184838848
898+c, tdbSNP:199713326
919+a, gdbSNP:200586394
926+c, tdbSNP:1295685
942+g, tdbSNP:199903635
952+c, tdbSNP:200557616
981+g, tdbSNP:848
998+a, gdbSNP:200202231
1037+c, tdbSNP:189329440
1048+a, gdbSNP:202204367
1057+c, tdbSNP:181985600
1059+c, tdbSNP:201076793
1060+c, gdbSNP:202147858
1067+a, gdbSNP:200189368
1078+c, gdbSNP:2069750
1096+g, tdbSNP:202102174
1103+c, gdbSNP:200635007
1107+c, tdbSNP:116240019
1150+a, gdbSNP:847
1196+a, gdbSNP:138637232
1233+g, tdbSNP:143032763
1243+a, gdbSNP:199848775
Gene SymbolIL13
Gene SynonymALRH; BHR1; IL-13; P600
Chromosome5
Locus Map5q31
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002188 Homo sapiens interleukin 13 (IL13), mRNA. Full Length $371.78
ORF Sequence $159.00
Title Association between IL13 gene polymorphisms and susceptibility to cancer: a meta-analysis .
Author Su,T., Mi,Y., Zhang,L., Wang,S., Lu,H., Shi,L., Sun,H., Wu,X., Zhang,W., Zuo,L. and Zou,J.
Journal Gene 515 (1), 56-61 (2013)
Title From macrophage interleukin-13 receptor to foam cell formation: mechanisms for alphaMbeta2 integrin interference .
Author Yakubenko,V.P., Hsi,L.C., Cathcart,M.K. and Bhattacharjee,A.
Journal J. Biol. Chem. 288 (4), 2778-2788 (2013)
Title Cytokine stimulation of epithelial cancer cells: the similar and divergent functions of IL-4 and IL-13 .
Author Hallett,M.A., Venmar,K.T. and Fingleton,B.
Journal Cancer Res. 72 (24), 6338-6343 (2012)
Title Interleukin 13 exposure enhances vitamin D-mediated expression of the human cathelicidin antimicrobial peptide 18/LL-37 in bronchial epithelial cells .
Author Schrumpf,J.A., van Sterkenburg,M.A., Verhoosel,R.M., Zuyderduyn,S. and Hiemstra,P.S.
Journal Infect. Immun. 80 (12), 4485-4494 (2012)
Title Leukotriene D4 and interleukin-13 cooperate to increase the release of eotaxin-3 by airway epithelial cells .
Author Provost,V., Langlois,A., Chouinard,F., Rola-Pleszczynski,M., Chakir,J., Flamand,N. and Laviolette,M.
Journal PLoS ONE 7 (8), E43544 (2012)
Title Tandem arrangement of human genes for interleukin-4 and interleukin-13: resemblance in their organization .
Author Smirnov,D.V., Smirnova,M.G., Korobko,V.G. and Frolova,E.I.
Journal Gene 155 (2), 277-281 (1995)
Title Regulation of endothelial and mesothelial cell function by interleukin-13: selective induction of vascular cell adhesion molecule-1 and amplification of interleukin-6 production .
Author Sironi,M., Sciacca,F.L., Matteucci,C., Conni,M., Vecchi,A., Bernasconi,S., Minty,A., Caput,D., Ferrara,P., Colotta,F. et al.
Journal Blood 84 (6), 1913-1921 (1994)
Title Predictive modelling of the 3-D structure of interleukin-13 .
Author Bamborough,P., Duncan,D. and Richards,W.G.
Journal Protein Eng. 7 (9), 1077-1082 (1994)
Title Interleukin-13 is a new human lymphokine regulating inflammatory and immune responses .
Author Minty,A., Chalon,P., Derocq,J.M., Dumont,X., Guillemot,J.C., Kaghad,M., Labit,C., Leplatois,P., Liauzun,P., Miloux,B. et al.
Journal Nature 362 (6417), 248-250 (1993)
Title The selective isolation of novel cDNAs encoded by the regions surrounding the human interleukin 4 and 5 genes .
Author Morgan,J.G., Dolganov,G.M., Robbins,S.E., Hinton,L.M. and Lovett,M.
Journal Nucleic Acids Res. 20 (19), 5173-5179 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878