• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 13 (IL13), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002188 Homo sapiens interleukin 13 (IL13), mRNA. Full Lenth $371.78
ORF Sequence $159.00


RefSeq Version NM_002188.2, 26787977
Length 1282 bp
Structure linear
Update Date 24-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 13 (IL13), mRNA.
Product interleukin-13 precursor
Comment

Summary: This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq].

RefSeq NP_002179.2
CDS 15..455
Exon (1)1..188
Exon (2)189..242
Exon (3)243..347
Exon (4)348..1282
Translation MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP LCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD TKIEVAQFVKDLLLHLKKLFREGQFN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
3+c, gdbSNP:76471112
74+c, tdbSNP:55733734
76+c, tdbSNP:78181870
149+c, gdbSNP:56035208
complement(167)-t, gdbSNP:34255686
complement(250)-t, gdbSNP:34654684
383+c, tdbSNP:78628956
complement(445)-t, cdbSNP:20541
451+a, cdbSNP:56258826
492+c, tdbSNP:2069749
498+c, tdbSNP:56318025
506+a, gdbSNP:75868517
770+a, tdbSNP:115325936
complement(926)-t, cdbSNP:1295685
complement(981)-t, gdbSNP:848
1078+c, gdbSNP:2069750
1107+c, tdbSNP:116240019
complement(1150)-g, adbSNP:847
Gene SymbolIL13
Gene SynonymALRH; BHR1; IL-13; MGC116786; MGC116788; MGC116789; P600
Chromosome5
Locus Map5q31
All Transcripts NM_002188
Title Association of functional polymorphisms in promoter regions of IL5, IL6 and IL13 genes with development and prognosis of autoimmune thyroid diseases .
Author Inoue,N., Watanabe,M., Morita,M., Tatusmi,K., Hidaka,Y., Akamizu,T. and Iwatani,Y.
Journal Clin. Exp. Immunol. 163 (3), 318-323 (2011)
Title Expression of matrix metalloproteinase-13 is controlled by IL-13 via PI3K/Akt3 and PKC-delta in normal human dermal fibroblasts .
Author Moriya,C., Jinnin,M., Yamane,K., Maruo,K., Muchemwa,F.C., Igata,T., Makino,T., Fukushima,S. and Ihn,H.
Journal J. Invest. Dermatol. 131 (3), 655-661 (2011)
Title Production of interleukin-13 is influenced by the interleukin-4 -34TT and -590TT genotype in patients with aggressive periodontitis .
Author Gonzales,J.R., Groger,S., Haley,G., Bodeker,R.H. and Meyle,J.
Journal Scand. J. Immunol. 73 (2), 128-134 (2011)
Title The interleukin 13 (IL-13) pathway in human macrophages is modulated by microRNA-155 via direct targeting of interleukin 13 receptor alpha1 (IL13Ralpha1) .
Author Martinez-Nunez,R.T., Louafi,F. and Sanchez-Elsner,T.
Journal J. Biol. Chem. 286 (3), 1786-1794 (2011)
Title Risk of cervical cancer associated with allergies and polymorphisms in genes in the chromosome 5 cytokine cluster .
Author Johnson,L.G., Schwartz,S.M., Malkki,M., Du,Q., Petersdorf,E.W., Galloway,D.A. and Madeleine,M.M.
Journal Cancer Epidemiol. Biomarkers Prev. 20 (1), 199-207 (2011)
Title Tandem arrangement of human genes for interleukin-4 and interleukin-13: resemblance in their organization .
Author Smirnov,D.V., Smirnova,M.G., Korobko,V.G. and Frolova,E.I.
Journal Gene 155 (2), 277-281 (1995)
Title Regulation of endothelial and mesothelial cell function by interleukin-13: selective induction of vascular cell adhesion molecule-1 and amplification of interleukin-6 production .
Author Sironi,M., Sciacca,F.L., Matteucci,C., Conni,M., Vecchi,A., Bernasconi,S., Minty,A., Caput,D., Ferrara,P., Colotta,F. et al.
Journal Blood 84 (6), 1913-1921 (1994)
Title Predictive modelling of the 3-D structure of interleukin-13 .
Author Bamborough,P., Duncan,D. and Richards,W.G.
Journal Protein Eng. 7 (9), 1077-1082 (1994)
Title Interleukin-13 is a new human lymphokine regulating inflammatory and immune responses .
Author Minty,A., Chalon,P., Derocq,J.M., Dumont,X., Guillemot,J.C., Kaghad,M., Labit,C., Leplatois,P., Liauzun,P., Miloux,B. et al.
Journal Nature 362 (6417), 248-250 (1993)
Title The selective isolation of novel cDNAs encoded by the regions surrounding the human interleukin 4 and 5 genes .
Author Morgan,J.G., Dolganov,G.M., Robbins,S.E., Hinton,L.M. and Lovett,M.
Journal Nucleic Acids Res. 20 (19), 5173-5179 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878