• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 13 (IL13), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002188 Homo sapiens interleukin 13 (IL13), mRNA. GenEZ ORF Cloning In-stock $248.00 $199.00 10

*Business Day

Related Services

RefSeq Version NM_002188.2, 26787977
Length 1282 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 13 (IL13), mRNA.
Product interleukin-13 precursor
Comment

Summary: This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq, Jul 2008].

RefSeq NP_002179.2
CDS 15..455
Misc Feature(1)72..449
Misc Feature(2)57..59
Exon (1)189..242
Gene:IL13
Gene Synonym:IL-13; P600
Exon (2)243..347
Gene:IL13
Gene Synonym:IL-13; P600
Exon (3)348..1282
Gene:IL13
Gene Synonym:IL-13; P600
Translation MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP LCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD TKIEVAQFVKDLLLHLKKLFREGQFN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
3+dbSNP:
3+c, gdbSNP:76471112
6+a, cdbSNP:202009492
22+c, tdbSNP:200168712
34+a, cdbSNP:201121980
48+c, tdbSNP:202050622
61+c, tdbSNP:376870298
62+a, gdbSNP:199924106
69+c, tdbSNP:201053365
74+c, tdbSNP:55733734
76+c, tdbSNP:78181870
89+c, gdbSNP:200186367
101+c, tdbSNP:201424420
116+a, gdbSNP:202220644
122+c, tdbSNP:200638839
136+c, tdbSNP:374069088
139+a, cdbSNP:200571678
143+c, tdbSNP:202011628
149+c, gdbSNP:56035208
167+g, tdbSNP:34255686
190+dbSNP:
190+c, tdbSNP:138680496
193+c, tdbSNP:146770163
194+a, gdbSNP:140369292
197+c, tdbSNP:371914367
204+a, gdbSNP:199869056
216+c, tdbSNP:143660447
229+c, tdbSNP:148077750
234+g, tdbSNP:200120288
248+dbSNP:
248+c, tdbSNP:192837804
250+g, tdbSNP:34654684
254+c, tdbSNP:150226731
266+c, gdbSNP:200913948
272+c, tdbSNP:201716976
274+g, tdbSNP:199513811
301+a, cdbSNP:374668631
312+c, gdbSNP:200793410
328+c, tdbSNP:201804555
329+a, gdbSNP:200113399
364+dbSNP:
364+a, gdbSNP:184944562
370+a, gdbSNP:140828306
381+a, gdbSNP:376384925
383+c, tdbSNP:78628956
384+a, gdbSNP:375653129
387+a, gdbSNP:140196099
404+a, gdbSNP:201624646
407+a, cdbSNP:200380202
435+c, tdbSNP:201475069
437+c, tdbSNP:199797009
440+c, g, tdbSNP:200247901
445+a, gdbSNP:386555165
451+a, cdbSNP:56258826
467+c, tdbSNP:374535004
492+c, tdbSNP:2069749
498+c, tdbSNP:56318025
506+a, gdbSNP:75868517
510+a, gdbSNP:201863406
542+g, tdbSNP:199516826
551+a, gdbSNP:200797041
609+c, tdbSNP:201802470
610+a, gdbSNP:200196698
615+c, tdbSNP:200786939
672+c, tdbSNP:375776378
675+c, tdbSNP:201490660
677+a, gdbSNP:199955551
690+c, tdbSNP:200895460
696+a, gdbSNP:202233186
711+a, gdbSNP:190222211
717+a, gdbSNP:150177673
750+a, tdbSNP:201185816
752+c, tdbSNP:202101165
755+a, gdbSNP:200632360
770+a, tdbSNP:115325936
778..779+, atdbSNP:149809253
792+c, gdbSNP:199511991
793+c, gdbSNP:200265585
803+a, cdbSNP:201420607
822+a, cdbSNP:199804866
841+c, gdbSNP:200650844
844+c, tdbSNP:201965069
893+c, tdbSNP:181825588
897+a, gdbSNP:184838848
898+c, tdbSNP:199713326
913+c, gdbSNP:368300404
919+a, gdbSNP:200586394
complement(926)-t, cdbSNP:1295685
926+a, gdbSNP:386526749
942+g, tdbSNP:199903635
952+c, tdbSNP:200557616
complement(981)-t, gdbSNP:848
998+a, gdbSNP:200202231
1037+c, tdbSNP:189329440
1048+a, gdbSNP:202204367
1057+c, tdbSNP:181985600
1059+c, tdbSNP:201076793
1060+c, gdbSNP:202147858
1067+a, gdbSNP:200189368
1078+c, gdbSNP:2069750
1091+a, gdbSNP:370110665
1096+g, tdbSNP:202102174
1103+c, gdbSNP:200635007
1107+c, tdbSNP:116240019
complement(1150)-g, adbSNP:847
1196+a, gdbSNP:138637232
1233+g, tdbSNP:143032763
1243+a, gdbSNP:199848775
Gene SymbolIL13
Gene SynonymIL-13; P600
Chromosome5
Locus Map5q31
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002188 Homo sapiens interleukin 13 (IL13), mRNA. In-stock $248.00 $199.00 10
Title Autocrine role of interleukin-13 on skeletal muscle glucose metabolism in type 2 diabetic patients involves microRNA let-7 .
Author Jiang LQ, Franck N, Egan B, Sjogren RJ, Katayama M, Duque-Guimaraes D, Arner P, Zierath JR and Krook A.
Journal Am. J. Physiol. Endocrinol. Metab. 305 (11), E1359-E1366 (2013)
Title A genome-wide association study of atopic dermatitis identifies loci with overlapping effects on asthma and psoriasis .
Author Weidinger S, Willis-Owen SA, Kamatani Y, Baurecht H, Morar N, Liang L, Edser P, Street T, Rodriguez E, O'Regan GM, Beattie P, Folster-Holst R, Franke A, Novak N, Fahy CM, Winge MC, Kabesch M, Illig T, Heath S, Soderhall C, Melen E, Pershagen G, Kere J, Bradley M, Lieden A, Nordenskjold M, Harper JI, McLean WH, Brown SJ, Cookson WO, Lathrop GM, Irvine AD and Moffatt MF.
Journal Hum. Mol. Genet. 22 (23), 4841-4856 (2013)
Title IL-13 gene polymorphisms and their association with atopic asthma and rhinitis in Pakistani patients .
Author Shazia M, Kanza M, Mehwish I, Irum S, Farida A and Asifa A.
Journal Iran J Allergy Asthma Immunol 12 (4), 391-396 (2013)
Title IL-13/IL-22-coproducing T cells, a novel subset, are increased in atopic dermatitis .
Author Teraki Y, Sakurai A and Izaki S.
Journal J. Allergy Clin. Immunol. 132 (4), 971-974 (2013)
Title Interleukin-13 and RANTES polymorphisms in relation to asthma in children of Chinese Han nationality .
Author Liu Q, Hua L, Fang D, Lin Q, Zhu Y, Gan X and Bao Y.
Journal Asian Pac. J. Allergy Immunol. 31 (3), 247-252 (2013)
Title Tandem arrangement of human genes for interleukin-4 and interleukin-13: resemblance in their organization .
Author Smirnov DV, Smirnova MG, Korobko VG and Frolova EI.
Journal Gene 155 (2), 277-281 (1995)
Title Regulation of endothelial and mesothelial cell function by interleukin-13: selective induction of vascular cell adhesion molecule-1 and amplification of interleukin-6 production .
Author Sironi M, Sciacca FL, Matteucci C, Conni M, Vecchi A, Bernasconi S, Minty A, Caput D, Ferrara P and Colotta F.
Journal Blood 84 (6), 1913-1921 (1994)
Title Predictive modelling of the 3-D structure of interleukin-13 .
Author Bamborough P, Duncan D and Richards WG.
Journal Protein Eng. 7 (9), 1077-1082 (1994)
Title Interleukin-13 is a new human lymphokine regulating inflammatory and immune responses .
Author Minty A, Chalon P, Derocq JM, Dumont X, Guillemot JC, Kaghad M, Labit C, Leplatois P, Liauzun P and Miloux B.
Journal Nature 362 (6417), 248-250 (1993)
Title The selective isolation of novel cDNAs encoded by the regions surrounding the human interleukin 4 and 5 genes .
Author Morgan JG, Dolganov GM, Robbins SE, Hinton LM and Lovett M.
Journal Nucleic Acids Res. 20 (19), 5173-5179 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.