• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens integrin, alpha V (ITGAV), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_002210 Homo sapiens integrin, alpha V (ITGAV), transcript variant 1, mRNA. ORF Sequence $1101.45
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002210.3, 223468593
Length 7047 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens integrin, alpha V (ITGAV), transcript variant 1, mRNA.
Product integrin alpha-V isoform 1
Comment

Summary: ITAGV encodes integrin alpha chain V. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The I-domain containing integrin alpha V undergoes post-translational cleavage to yield disulfide-linked heavy and light chains, that combine with multiple integrin beta chains to form different integrins. Among the known associating beta chains (beta chains 1,3,5,6, and 8; 'ITGB1', 'ITGB3', 'ITGB5', 'ITGB6', and 'ITGB8'), each can interact with extracellular matrix ligands; the alpha V beta 3 integrin, perhaps the most studied of these, is referred to as the Vitronectin receptor (VNR). In addition to adhesion, many integrins are known to facilitate signal transduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002201.1
CDS 277..3423
Misc Feature(1)370..570
Misc Feature(2)370..570
Misc Feature(3)412..585
Misc Feature(4)601..786
Misc Feature(5)793..951
Misc Feature(6)937..1086
Misc Feature(7)985..1161
Misc Feature(8)1018..>1140
Misc Feature(9)1054..1251
Misc Feature(10)1162..1347
Misc Feature(11)1180..1341
Misc Feature(12)1216..1446
Misc Feature(13)1348..1521
Misc Feature(14)1375..1539
Misc Feature(15)1411..1638
Misc Feature(16)1531..1722
Misc Feature(17)1576..1704
Misc Feature(18)1675..3018
Misc Feature(19)3253..3324
Misc Feature(20)3331..3345
Misc Feature(21)3418..3420
Exon (1)1..461
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (2)462..592
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (3)593..684
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (4)685..799
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (5)800..861
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (6)862..907
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (7)908..1033
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (8)1034..1078
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (9)1079..1122
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (10)1123..1179
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (11)1180..1232
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (12)1233..1435
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (13)1436..1627
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (14)1628..1673
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (15)1674..1781
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (16)1782..1840
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (17)1841..1995
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (18)1996..2133
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (19)2134..2201
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (20)2202..2349
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (21)2350..2442
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (22)2443..2522
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (23)2523..2603
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (24)2604..2709
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (25)2710..2868
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (26)2869..2982
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (27)2983..3096
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (28)3097..3204
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (29)3205..3327
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Exon (30)3328..7032
Gene:ITGAV
Gene Synonym:CD51; MSK8; VNRA; VTNR
Translation MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK AQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP DHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF FKRVRPPQEEQEREQLQPHENGEGNSET
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
26+dbSNP:
26+a, gdbSNP:201026553
50+c, gdbSNP:199607564
62+c, gdbSNP:200578800
64+c, tdbSNP:61763603
65+a, c, gdbSNP:61763604
68+g, tdbSNP:61763605
84+g, tdbSNP:199768134
91+g, tdbSNP:185068200
226+a, gdbSNP:201679057
227+g, tdbSNP:199679731
230+a, gdbSNP:200762760
343+c, tdbSNP:201836720
351+a, gdbSNP:144478131
372+c, tdbSNP:200542347
379+a, gdbSNP:201056969
386+c, gdbSNP:199896935
396+c, gdbSNP:200993212
432+c, gdbSNP:61763606
442+c, tdbSNP:200143768
444+c, gdbSNP:201076250
463+dbSNP:
463+c, tdbSNP:142312022
467+a, tdbSNP:200511786
477+c, tdbSNP:142322882
478+a, gdbSNP:201391436
498+c, tdbSNP:199568296
502+a, g, tdbSNP:55719435
511+c, gdbSNP:201827776
557+c, tdbSNP:150221000
559+c, tdbSNP:199804238
562+c, tdbSNP:200516634
563+a, gdbSNP:201909609
574+a, gdbSNP:201231113
603+dbSNP:
603+g, tdbSNP:200368244
621+a, tdbSNP:201045521
623+g, tdbSNP:201993598
638+a, gdbSNP:200441010
677+a, cdbSNP:201507967
715+dbSNP:
715+c, gdbSNP:199565015
717+a, gdbSNP:114767222
759+a, gdbSNP:201809110
772+a, gdbSNP:148135826
785+c, tdbSNP:200143155
792+c, tdbSNP:185931097
808+dbSNP:
808+a, gdbSNP:201182344
832+c, tdbSNP:202244021
871+dbSNP:
871+a, gdbSNP:202112395
927+dbSNP:
927+a, gdbSNP:200856961
929+c, tdbSNP:201504027
939+c, tdbSNP:199813220
940+a, gdbSNP:200647242
951+c, tdbSNP:149545302
958+a, gdbSNP:199724726
959+a, gdbSNP:200674397
984+c, tdbSNP:150746738
999+a, gdbSNP:201616731
1026+c, tdbSNP:139119479
1059+dbSNP:
1059+c, tdbSNP:113154595
1061+a, gdbSNP:184114187
1087+dbSNP:
1087+c, tdbSNP:202002317
1089+a, gdbSNP:201225541
1093+a, gdbSNP:200557809
1107+a, gdbSNP:201025247
1109+a, gdbSNP:199603191
1155+dbSNP:
1155+c, tdbSNP:201933397
1171+a, gdbSNP:199654707
1173+c, tdbSNP:140473956
1174+a, gdbSNP:201930300
1207+dbSNP:
1207+a, c, gdbSNP:200171726
1210+g, tdbSNP:200935847
1217+a, tdbSNP:113237121
1224+c, tdbSNP:144530237
1236+dbSNP:
1236+c, tdbSNP:201118947
1243+g, tdbSNP:199660104
1303+a, gdbSNP:200548852
1305+a, gdbSNP:201288822
1324+c, tdbSNP:140715466
1329+a, gdbSNP:140516074
1364+a, gdbSNP:199566451
1365+a, cdbSNP:200626232
1376+c, tdbSNP:146613742
1377+c, tdbSNP:201824820
1396+a, gdbSNP:200664669
1417+a, gdbSNP:200514227
1442+dbSNP:
1442+c, tdbSNP:145167954
1462+c, gdbSNP:200860444
1463+g, tdbSNP:201819463
1489+a, gdbSNP:3738918
1496+a, gdbSNP:200746724
1502+g, tdbSNP:143468341
1506+a, tdbSNP:202183151
1518+c, tdbSNP:200418625
1525+c, gdbSNP:201689701
1536+c, tdbSNP:200917427
1549+g, tdbSNP:141692700
1558+c, tdbSNP:201541903
1574+c, gdbSNP:200189367
1583+a, gdbSNP:201332846
1605+c, tdbSNP:199695772
1643+dbSNP:
1643+c, tdbSNP:200462398
1688+dbSNP:
1688+c, tdbSNP:201241523
1700+a, cdbSNP:202007073
1702+a, gdbSNP:200310686
1704+c, tdbSNP:111900386
1716+c, tdbSNP:201680116
1731+c, tdbSNP:199768047
1738+a, tdbSNP:142779223
1739+a, gdbSNP:200705825
1749+c, tdbSNP:201402480
1760+c, gdbSNP:147403786
1780+c, tdbSNP:149953343
1813+dbSNP:
1813+a, gdbSNP:202013444
1839+c, tdbSNP:199961868
1902+dbSNP:
1902+c, gdbSNP:201056056
1918+g, tdbSNP:2230615
1924+a, gdbSNP:200088164
1931+c, tdbSNP:146565475
1939+a, tdbSNP:200277128
1944+g, tdbSNP:201383703
1945+a, gdbSNP:201190961
1954+g, tdbSNP:199845024
1958+g, tdbSNP:185792013
1971+c, tdbSNP:200701431
1984+a, gdbSNP:201670713
1985+c, tdbSNP:199670325
1986+a, gdbSNP:112803582
1987+a, tdbSNP:201927835
2050+dbSNP:
2050+c, tdbSNP:200949549
2051+a, gdbSNP:201898547
2057+a, gdbSNP:200210960
2103+c, tdbSNP:201113283
2107+c, tdbSNP:200254694
2109+c, tdbSNP:199728735
2111+c, tdbSNP:150474737
2145+dbSNP:
2145+a, cdbSNP:202049054
2184+a, gdbSNP:201353911
2186+a, cdbSNP:137918565
2196+a, gdbSNP:199795921
2197+c, gdbSNP:199902091
2219+dbSNP:
2219+a, gdbSNP:201180647
2222+c, tdbSNP:200809220
2239+c, tdbSNP:202078042
2259+c, tdbSNP:199519178
2282+a, gdbSNP:199857837
2283+c, tdbSNP:200857823
2296+a, gdbSNP:138771382
2328+c, tdbSNP:147413915
2329+a, gdbSNP:200130364
2337+c, gdbSNP:200743888
2345+a, cdbSNP:200352884
2350+dbSNP:
2350+c, gdbSNP:201558849
2353+g, tdbSNP:200058229
2425+a, gdbSNP:199555610
2443+dbSNP:
2443+c, g, tdbSNP:202242205
2466+c, tdbSNP:141799268
2489+a, tdbSNP:201172979
2493+c, tdbSNP:202075539
2518+c, tdbSNP:150189251
2523+dbSNP:
2523+c, gdbSNP:201510096
2558+c, tdbSNP:150579951
2580+a, tdbSNP:200671949
2614+dbSNP:
2614+c, tdbSNP:200169203
2621+a, gdbSNP:199914502
2623+a, gdbSNP:2230616
2624+c, tdbSNP:200258394
2634+g, tdbSNP:140099606
2651+a, gdbSNP:201916887
2655+a, gdbSNP:146857052
2662+a, cdbSNP:201122594
2671+a, gdbSNP:202170056
2680+a, gdbSNP:193173970
2685+g, tdbSNP:200191747
2697+a, gdbSNP:201169088
2720+dbSNP:
2720+a, gdbSNP:61757099
2742+a, gdbSNP:201297169
2766+g, tdbSNP:41270223
2774+a, gdbSNP:199789114
2782+a, gdbSNP:199591827
2807+a, gdbSNP:142978189
2809+a, gdbSNP:113568226
2898+dbSNP:
2898+c, tdbSNP:199650772
2904+a, gdbSNP:200927719
2910+c, tdbSNP:141095012
2931+c, tdbSNP:2230617
2932+c, gdbSNP:201902686
2944+c, tdbSNP:199887925
2945+a, gdbSNP:181427404
2959+a, gdbSNP:201781970
2973+c, tdbSNP:200106228
2982+g, tdbSNP:200930525
2983+dbSNP:
2983+a, gdbSNP:201106619
2985+a, c, tdbSNP:138642568
3011+c, tdbSNP:112911535
3012+c, tdbSNP:138043193
3021+a, cdbSNP:149499557
3026+a, gdbSNP:201617888
3040+a, gdbSNP:199560379
3042+a, gdbSNP:148285486
3047+a, gdbSNP:56316527
3057+a, gdbSNP:140014289
3060+c, tdbSNP:199793723
3061+a, gdbSNP:146319338
3078+g, tdbSNP:139359558
3096+a, tdbSNP:145339092
3110+dbSNP:
3110+a, gdbSNP:200733186
3115+a, tdbSNP:199524190
3121+g, tdbSNP:202153093
3129+a, gdbSNP:200299043
3195+c, tdbSNP:61764171
3239+dbSNP:
3239+c, tdbSNP:200757637
3240+a, gdbSNP:140775791
3246+g, tdbSNP:182320312
3263+a, tdbSNP:199555943
3283+g, tdbSNP:78078317
3300+c, gdbSNP:200670826
3304..3305+, ggttgggttdbSNP:145060863
3305+g, tdbSNP:202006432
3310+a, gdbSNP:200142528
3326+a, gdbSNP:138581244
3332+dbSNP:
3332+a, gdbSNP:200510282
3348+c, tdbSNP:148284429
3350+a, gdbSNP:138816496
3351+c, gdbSNP:202001919
3386+a, gdbSNP:200306740
3392+a, gdbSNP:201434983
3406+a, gdbSNP:144676143
3425+c, tdbSNP:199754402
3426+a, gdbSNP:200173602
3442+a, gdbSNP:200696353
3470+a, gdbSNP:201394220
3471+c, gdbSNP:199671877
3486+a, gdbSNP:77451111
3518+a, cdbSNP:201607731
3522+a, cdbSNP:199577354
3536+c, tdbSNP:200562059
3661+a, gdbSNP:202000859
3686+a, gdbSNP:200129983
3702+g, tdbSNP:201039453
3706+a, tdbSNP:201659257
3752+g, tdbSNP:199952134
3755+a, gdbSNP:201122449
3757+a, gdbSNP:202163143
3760+c, tdbSNP:200177911
3767+g, tdbSNP:200967097
3771..3772+, gtdbSNP:111276487
3773..3774+, gttdbSNP:61764176
3773+, gttdbSNP:56341611
3791+a, gdbSNP:202208877
3800+g, tdbSNP:200505817
3855+a, tdbSNP:201782815
3864+c, tdbSNP:199563876
3866+c, tdbSNP:200276350
3870+c, tdbSNP:150780090
3922+g, tdbSNP:199833522
3943+c, tdbSNP:115049718
3982+a, gdbSNP:200456774
3988+c, tdbSNP:201664035
4025+a, tdbSNP:199667033
4043+c, tdbSNP:61764177
4045+a, tdbSNP:202076856
4101+a, gdbSNP:199884589
4121+c, tdbSNP:200977595
4145+a, gdbSNP:201778400
4194+a, cdbSNP:139597038
4205+a, gdbSNP:201032461
4246+c, tdbSNP:201989404
4269+a, cdbSNP:200435942
4280+a, gdbSNP:201166506
4304+a, tdbSNP:202239210
4310+a, g, tdbSNP:200204542
4325+a, gdbSNP:186944239
4341..4344+, agtadbSNP:3835765
4344+a, tdbSNP:201799358
4345+a, tdbSNP:200345939
4354+g, tdbSNP:201778906
4362+a, gdbSNP:199555239
4375+a, tdbSNP:200817112
4377+a, tdbSNP:193248457
4391+g, tdbSNP:114785095
4416+c, tdbSNP:201482806
4438+a, tdbSNP:199784786
4456+a, tdbSNP:200503782
4463+a, gdbSNP:142831717
4472+a, cdbSNP:199961878
4527+a, tdbSNP:11891461
4556+c, tdbSNP:202073449
4584+a, gdbSNP:199853846
4612+c, tdbSNP:184002540
4616+a, gdbSNP:201171092
4627+a, gdbSNP:201807782
4631+c, gdbSNP:11902171
4655+g, tdbSNP:200738127
4660+c, tdbSNP:201709573
4689+a, gdbSNP:146095832
4706+a, gdbSNP:7556971
4728+a, gdbSNP:202237889
4778+a, gdbSNP:1839123
4785+a, gdbSNP:201506699
4810+c, tdbSNP:199677288
4832+a, gdbSNP:200752999
4836+c, tdbSNP:201554462
4839+a, gdbSNP:199562327
4841+a, tdbSNP:200813988
4897+g, tdbSNP:201782524
4929+c, tdbSNP:200165648
4940+g, tdbSNP:200598219
4957+a, cdbSNP:201400608
4964+a, g, tdbSNP:200017755
4968+a, gdbSNP:200952292
4973+a, gdbSNP:201901402
5005+a, gdbSNP:199844316
5008+a, gdbSNP:201163584
5031+a, gdbSNP:202067390
5049+c, gdbSNP:200540681
5058+c, tdbSNP:201226800
5079+c, tdbSNP:61764178
5093+a, gdbSNP:115551804
5107+c, gdbSNP:200303687
5162+a, gdbSNP:201436320
5163+c, tdbSNP:199797306
5193+a, gdbSNP:200221860
5209+c, tdbSNP:201502685
5221+a, cdbSNP:199644540
5285+a, tdbSNP:200922975
5298+a, tdbSNP:75144691
5300+a, tdbSNP:76982754
5302+g, tdbSNP:78655668
5303+a, gdbSNP:140003020
5332+c, gdbSNP:201606621
5336+c, tdbSNP:1054194
5374+c, gdbSNP:199574041
5376+c, gdbSNP:200562291
5382+c, tdbSNP:201526449
5410+a, tdbSNP:200160935
5413+c, tdbSNP:78678728
5414+a, gdbSNP:201905509
5428+a, cdbSNP:199982506
5449+g, tdbSNP:201118268
5520+c, tdbSNP:202164247
5529+a, cdbSNP:200186331
5565+a, gdbSNP:200968694
5567+a, tdbSNP:202063034
5590+c, tdbSNP:1054197
5627..5628+, ttdbSNP:71654150
5627+a, g, tdbSNP:200536640
5627+, tdbSNP:34116658
5628+a, tdbSNP:201603737
5634+a, tdbSNP:199559365
5635+a, tdbSNP:200275250
5653+a, gdbSNP:201185281
5656+a, tdbSNP:61764179
5732+c, gdbSNP:200453005
5796+g, tdbSNP:149772704
5841+c, tdbSNP:201407854
5871+a, c, tdbSNP:113758625
5891+c, tdbSNP:199642191
5893+a, tdbSNP:200919576
5917+c, tdbSNP:201899647
5929+a, gdbSNP:188594164
5938+c, tdbSNP:199907587
5965+a, tdbSNP:200979373
5973..5974+, aadbSNP:200140082
6004+a, gdbSNP:61764180
6030+a, cdbSNP:148594846
6055+a, gdbSNP:200102802
6056..6057+, cdbSNP:34148433
6065+a, gdbSNP:200841676
6079+a, gdbSNP:202175563
6080+g, tdbSNP:199976674
6086+a, gdbSNP:201285380
6090+a, gdbSNP:202153455
6131+c, tdbSNP:200205831
6150+a, gdbSNP:201103137
6154+c, tdbSNP:201798136
6159+a, gdbSNP:200341974
6165+c, tdbSNP:201602341
6167+c, tdbSNP:199554402
6168+a, gdbSNP:61764181
6174+a, gdbSNP:192933940
6177+c, tdbSNP:142912503
6180+c, tdbSNP:61764182
6181+a, gdbSNP:200505465
6192+a, gdbSNP:183878241
6199+a, cdbSNP:201678718
6200+a, gdbSNP:199951814
6201+a, cdbSNP:200737676
6264+c, tdbSNP:201893346
6269+c, tdbSNP:199901961
6290+c, tdbSNP:201056699
6309+c, tdbSNP:202210913
6330+a, gdbSNP:200120654
6339+a, gdbSNP:201022823
6350+a, cdbSNP:201700373
6394+c, tdbSNP:61764183
6446+a, gdbSNP:201669701
6461+a, cdbSNP:202150481
6478+a, gdbSNP:200292662
6486+a, gdbSNP:201398136
6501..6503+, catdbSNP:61764184
6504+a, gdbSNP:199674008
6509+a, cdbSNP:151082691
6517+a, gdbSNP:200748501
6548+a, gdbSNP:201544664
6571+c, gdbSNP:199552924
6594+c, tdbSNP:200669626
6609+a, gdbSNP:202002715
6649+a, tdbSNP:200131539
6651+g, tdbSNP:200684254
6657+c, tdbSNP:13482
6678+g, tdbSNP:201651558
6693+, adbSNP:202212564
6704+a, gdbSNP:200014885
6720+a, cdbSNP:61764185
6732+a, c, gdbSNP:187048553
6735+a, gdbSNP:199915805
6746+a, c, tdbSNP:201055405
6751+a, gdbSNP:202209506
6762+c, gdbSNP:191851513
6790+a, gdbSNP:200504455
6810+a, gdbSNP:183616377
6833+c, tdbSNP:201989793
6849+c, tdbSNP:200294230
6850+a, gdbSNP:201428295
6889+a, cdbSNP:1054264
6895+c, gdbSNP:199793519
6910+c, gdbSNP:200263255
6940+c, gdbSNP:201392645
Gene SymbolITGAV
Gene SynonymCD51; MSK8; VNRA; VTNR
Chromosome2
Locus Map2q31-q32
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001144999 Homo sapiens integrin, alpha V (ITGAV), transcript variant 2, mRNA. Full Length $3046.05
ORF Sequence $1053.15
NM_001145000 Homo sapiens integrin, alpha V (ITGAV), transcript variant 3, mRNA. Full Length $3125.25
ORF Sequence $1063.65
NM_002210 Homo sapiens integrin, alpha V (ITGAV), transcript variant 1, mRNA. Full Length $3173.85
ORF Sequence $1101.45
Title Longitudinal expression analysis of alphav integrins in human gliomas reveals upregulation of integrin alphavbeta3 as a negative prognostic factor .
Author Schittenhelm,J., Schwab,E.I., Sperveslage,J., Tatagiba,M., Meyermann,R., Fend,F., Goodman,S.L. and Sipos,B.
Journal J. Neuropathol. Exp. Neurol. 72 (3), 194-210 (2013)
Title Integrin and defensin modulate the mechanical properties of adenovirus .
Author Snijder,J., Reddy,V.S., May,E.R., Roos,W.H., Nemerow,G.R. and Wuite,G.J.
Journal J. Virol. 87 (5), 2756-2766 (2013)
Title Cathepsin H mediates the processing of talin and regulates migration of prostate cancer cells .
Author Jevnikar,Z., Rojnik,M., Jamnik,P., Doljak,B., Fonovic,U.P. and Kos,J.
Journal J. Biol. Chem. 288 (4), 2201-2209 (2013)
Title Interplay between alphavbeta3 integrin and nucleolin regulates human endothelial and glioma cell migration .
Author Koutsioumpa,M., Polytarchou,C., Courty,J., Zhang,Y., Kieffer,N., Mikelis,C., Skandalis,S.S., Hellman,U., Iliopoulos,D. and Papadimitriou,E.
Journal J. Biol. Chem. 288 (1), 343-354 (2013)
Title alphavbeta3-integrin is a major sensor and activator of innate immunity to herpes simplex virus-1 .
Author Gianni,T., Leoni,V., Chesnokova,L.S., Hutt-Fletcher,L.M. and Campadelli-Fiume,G.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (48), 19792-19797 (2012)
Title Characterization of the integrin alpha v beta 6 as a fibronectin-binding protein .
Author Busk,M., Pytela,R. and Sheppard,D.
Journal J. Biol. Chem. 267 (9), 5790-5796 (1992)
Title Cloning and expression of a divergent integrin subunit beta 8 .
Author Moyle,M., Napier,M.A. and McLean,J.W.
Journal J. Biol. Chem. 266 (29), 19650-19658 (1991)
Title Purification and functional characterization of integrin alpha v beta 5. An adhesion receptor for vitronectin .
Author Smith,J.W., Vestal,D.J., Irwin,S.V., Burke,T.A. and Cheresh,D.A.
Journal J. Biol. Chem. 265 (19), 11008-11013 (1990)
Title A novel fibronectin receptor with an unexpected subunit composition (alpha v beta 1) .
Author Vogel,B.E., Tarone,G., Giancotti,F.G., Gailit,J. and Ruoslahti,E.
Journal J. Biol. Chem. 265 (11), 5934-5937 (1990)
Title The integrin beta 1 subunit associates with the vitronectin receptor alpha v subunit to form a novel vitronectin receptor in a human embryonic kidney cell line .
Author Bodary,S.C. and McLean,J.W.
Journal J. Biol. Chem. 265 (11), 5938-5941 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878