• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens CD82 molecule (CD82), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu26932 Homo sapiens CD82 molecule (CD82), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu26932C Homo sapiens CD82 molecule (CD82), transcript variant 1, mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002231.3, 67782352
Length 804 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens CD82 molecule (CD82), transcript variant 1, mRNA.
Product CD82 antigen isoform 1
Comment

Summary: This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_002222.1
CDS 249..1052
Misc Feature(1)54..56
Misc Feature(2)54..56
Misc Feature(3)282..344
Misc Feature(4)282..344
Misc Feature(5)318..1016
Misc Feature(6)408..464
Misc Feature(7)498..578
Misc Feature(8)564..935
Misc Feature(9)order(570..572,585..587,597..599,603..608,615..617,
Misc Feature(10)633..635
Misc Feature(11)717..719
Misc Feature(12)840..842
Misc Feature(13)933..998
Exon (1)1..146
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (2)147..228
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (3)229..311
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (4)312..384
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (5)385..509
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (6)510..584
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (7)585..686
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (8)687..890
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (9)891..974
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (10)975..1715
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Translation MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFI GVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGI VTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKG EEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAI IELLGMVLSICLCRHVHSEDYSKVPKY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
64+c, tdbSNP:182579675
80+a, gdbSNP:11541048
225+dbSNP:
225+g, tdbSNP:11541050
245+dbSNP:
245+c, tdbSNP:200238062
252+a, gdbSNP:111718702
305+a, cdbSNP:372259856
343+dbSNP:
343+c, tdbSNP:148396643
352+c, tdbSNP:377535419
356+c, tdbSNP:138833231
384+c, tdbSNP:150533529
400+dbSNP:
400+a, cdbSNP:139889503
404+c, tdbSNP:374050393
407+g, tdbSNP:201294710
417+c, tdbSNP:371929631
419+c, tdbSNP:143270517
420+a, gdbSNP:375078073
428+c, tdbSNP:146594387
431+a, cdbSNP:372931321
complement(434)-t, cdbSNP:34170190
446+c, tdbSNP:375797501
461+c, tdbSNP:149844780
474+a, gdbSNP:369269460
486+a, gdbSNP:145881169
493+a, gdbSNP:148925723
500+g, tdbSNP:370728156
506+a, cdbSNP:35348953
complement(596)-dbSNP:
complement(596)-t, cdbSNP:2303865
599+a, gdbSNP:374008730
602+c, tdbSNP:883752
603+a, gdbSNP:368613608
complement(611)-t, cdbSNP:2303864
618+c, tdbSNP:138793220
642+c, tdbSNP:142819851
643+g, tdbSNP:117157354
647+g, tdbSNP:11541051
675+a, gdbSNP:200277144
698+dbSNP:
698+c, tdbSNP:150371864
705+a, gdbSNP:138109186
730+a, gdbSNP:373060622
731+c, tdbSNP:200149429
747+c, tdbSNP:149456679
748+a, gdbSNP:143845294
751+c, tdbSNP:377503391
758+c, tdbSNP:267602880
776+c, tdbSNP:139816598
777+a, gdbSNP:370975589
827+c, tdbSNP:141597594
828+a, gdbSNP:200920132
856+g, tdbSNP:200514878
901+dbSNP:
901+a, gdbSNP:146220817
913+a, c, tdbSNP:201290700
915+g, tdbSNP:372946885
926+a, gdbSNP:74375347
944+c, tdbSNP:142423874
947+c, tdbSNP:79095986
953+c, tdbSNP:190517526
954+a, gdbSNP:367797052
957+g, tdbSNP:371497237
968+c, tdbSNP:199858417
969+a, gdbSNP:1139971
971+c, tdbSNP:150062713
992+dbSNP:
992+c, gdbSNP:74885383
1008+c, tdbSNP:201405906
1014+a, gdbSNP:142351354
1016+c, gdbSNP:7107335
1022+c, tdbSNP:201650491
1041+c, tdbSNP:147912305
1042+c, tdbSNP:201671713
1043+c, gdbSNP:148874083
1064+c, tdbSNP:376795165
1073+c, tdbSNP:370925717
1077+g, tdbSNP:376175476
1168..1169+cg, tcdbSNP:386753094
1168+c, tdbSNP:4755266
1169+c, gdbSNP:77781241
1185+a, gdbSNP:371456705
1270+c, tdbSNP:374896443
1284+c, tdbSNP:71490073
1299+a, cdbSNP:116250454
1336+c, tdbSNP:193127050
1401+a, gdbSNP:1063031
1408+c, gdbSNP:12225877
1427+c, gdbSNP:371743094
1455+a, gdbSNP:113805595
1466+a, gdbSNP:112667982
1488+a, cdbSNP:6485552
1493+a, cdbSNP:370894393
1515+c, tdbSNP:374579809
1516+a, gdbSNP:145762348
1539+a, cdbSNP:367590200
1548+a, gdbSNP:111384781
1552+a, gdbSNP:143013555
1621+c, tdbSNP:190156561
1651+, cdbSNP:374072292
1708+, aadbSNP:398045166
1714..1715+, aadbSNP:397848957
Gene SymbolCD82
Gene Synonym4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Chromosome11
Locus Map11p11.2
Title Anti-miR-197 inhibits migration in HCC cells by targeting KAI 1/CD82 .
Author Dai W, Wang C, Wang F, Wang Y, Shen M, Chen K, Cheng P, Zhang Y, Yang J, Zhu R, Zhang H, Li J, Zheng Y, Lu J, Zhou Y, Xu L and Guo C.
Journal Biochem. Biophys. Res. Commun. 446 (2), 541-548 (2014)
Title CD82 regulates STAT5/IL-10 and supports survival of acute myelogenous leukemia cells .
Author Nishioka C, Ikezoe T, Yang J, Nobumoto A, Kataoka S, Tsuda M, Udaka
Journal Int. J. Cancer 134 (1), 55-64 (2014)
Title Prognostic significance of KAI1/CD82 in human melanoma and its role in cell migration and invasion through the regulation of ING4 .
Author Tang Y, Cheng Y, Martinka M, Ong CJ and Li G.
Journal Carcinogenesis 35 (1), 86-95 (2014)
Title Metastasis suppressor tetraspanin CD82/KAI1 regulates ubiquitylation of epidermal growth factor receptor .
Author Odintsova E, van Niel G, Conjeaud H, Raposo G, Iwamoto R, Mekada E and Berditchevski F.
Journal J. Biol. Chem. 288 (36), 26323-26334 (2013)
Title Role of KAI1/CD82 polymorphisms in colon cancer risk in Han Chinese population .
Author Ma ZB, Li K, Wang J and Guo GH.
Journal Med. Oncol. 30 (3), 668 (2013)
Title Molecular analyses of the association of CD4 with two members of the transmembrane 4 superfamily, CD81 and CD82 .
Author Imai T, Kakizaki M, Nishimura M and Yoshie O.
Journal J. Immunol. 155 (3), 1229-1239 (1995)
Title KAI1, a metastasis suppressor gene for prostate cancer on human chromosome 11p11.2 .
Author Dong,J.T., Lamb,P.W., Rinker-Schaeffer,C.W., Vukanovic,J., Ichikawa,T., Isaacs,J.T. and Barrett,J.C.
Journal Science 268 (5212), 884-886 (1995)
Title C33 antigen recognized by monoclonal antibodies inhibitory to human .
Author Imai T, Fukudome K, Takagi S, Nagira M, Furuse M, Fukuhara N, Nishimura M, Hinuma Y and Yoshie O.
Journal J. Immunol. 149 (9), 2879-2886 (1992)
Title Localization of metastasis suppressor gene(s) for prostatic cancer to the short arm of human chromosome 11 .
Author Ichikawa T, Ichikawa Y, Dong J, Hawkins AL, Griffin CA, Isaacs WB, Oshimura M, Barrett JC and Isaacs JT.
Journal Cancer Res. 52 (12), 3486-3490 (1992)
Title Genetic factors and suppression of metastatic ability of prostatic cancer .
Author Ichikawa T, Ichikawa Y and Isaacs JT.
Journal Cancer Res. 51 (14), 3788-3792 (1991)
Title A new superfamily of lymphoid and melanoma cell proteins with extensive homology to Schistosoma mansoni antigen Sm23 .
Author Gaugitsch HW, Hofer E, Huber NE, Schnabl E and Baumruker T.
Journal Eur. J. Immunol. 21 (2), 377-383 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.