• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens CD82 molecule (CD82), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002231 Homo sapiens CD82 molecule (CD82), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_002231.3, 67782352
Length 1715 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens CD82 molecule (CD82), transcript variant 1, mRNA.
Product CD82 antigen isoform 1
Comment

Summary: This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_002222.1
CDS 249..1052
Misc Feature(1)54..56
Misc Feature(2)54..56
Misc Feature(3)276..1016
Misc Feature(4)276..1016
Misc Feature(5)282..344
Misc Feature(6)408..464
Misc Feature(7)498..578
Misc Feature(8)564..929
Misc Feature(9)order(570..572,585..587,597..599,603..608,615..617,
Misc Feature(10)633..635
Misc Feature(11)717..719
Misc Feature(12)840..842
Misc Feature(13)933..998
Exon (1)1..146
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (2)147..228
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (3)229..311
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (4)312..384
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (5)385..509
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (6)510..584
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (7)585..686
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (8)687..890
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (9)891..974
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Exon (10)975..1715
Gene:CD82
Gene Synonym:4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Translation MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFI GVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGI VTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKG EEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAI IELLGMVLSICLCRHVHSEDYSKVPKY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
64+c, tdbSNP:182579675
80+a, gdbSNP:11541048
225+dbSNP:
225+g, tdbSNP:11541050
245+dbSNP:
245+c, tdbSNP:200238062
252+a, gdbSNP:111718702
343+dbSNP:
343+c, tdbSNP:148396643
356+c, tdbSNP:138833231
384+c, tdbSNP:150533529
400+dbSNP:
400+a, cdbSNP:139889503
407+g, tdbSNP:201294710
419+c, tdbSNP:143270517
428+c, tdbSNP:146594387
434+c, tdbSNP:34170190
461+c, tdbSNP:149844780
486+a, gdbSNP:145881169
493+a, gdbSNP:148925723
506+a, cdbSNP:35348953
596+dbSNP:
596+c, tdbSNP:2303865
602+c, tdbSNP:883752
611+c, tdbSNP:2303864
618+c, tdbSNP:138793220
642+c, tdbSNP:142819851
643+g, tdbSNP:117157354
647+g, tdbSNP:11541051
675+a, gdbSNP:200277144
698+dbSNP:
698+c, tdbSNP:150371864
705+a, gdbSNP:138109186
731+c, tdbSNP:200149429
747+c, tdbSNP:149456679
748+a, gdbSNP:143845294
776+c, tdbSNP:139816598
827+c, tdbSNP:141597594
828+a, gdbSNP:200920132
856+g, tdbSNP:200514878
901+dbSNP:
901+a, gdbSNP:146220817
913+c, tdbSNP:201290700
926+a, gdbSNP:74375347
944+c, tdbSNP:142423874
947+c, tdbSNP:79095986
953+c, tdbSNP:190517526
968+c, tdbSNP:199858417
969+a, gdbSNP:1139971
971+c, tdbSNP:150062713
992+dbSNP:
992+c, gdbSNP:74885383
1008+c, tdbSNP:201405906
1014+a, gdbSNP:142351354
1016+c, gdbSNP:7107335
1022+c, tdbSNP:201650491
1041+c, tdbSNP:147912305
1042+c, tdbSNP:201671713
1043+c, gdbSNP:148874083
1168+c, tdbSNP:4755266
1169+c, gdbSNP:77781241
1284+c, tdbSNP:71490073
1299+a, cdbSNP:116250454
1336+c, tdbSNP:193127050
1401+a, gdbSNP:1063031
1408+c, gdbSNP:12225877
1455+a, gdbSNP:113805595
1466+a, gdbSNP:112667982
1488+a, cdbSNP:6485552
1516+a, gdbSNP:145762348
1548+a, gdbSNP:111384781
1552+a, gdbSNP:143013555
1621+c, tdbSNP:190156561
1690+, a, aadbSNP:10540347
Gene SymbolCD82
Gene Synonym4F9; C33; GR15; IA4; KAI1; R2; SAR2; ST6; TSPAN27
Chromosome11
Locus Map11p11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001024844 Homo sapiens CD82 molecule (CD82), transcript variant 2, mRNA. On-demand $399.00 14
NM_002231 Homo sapiens CD82 molecule (CD82), transcript variant 1, mRNA. On-demand $449.00 14
Title CD82 inhibits canonical Wnt signalling by controlling the cellular distribution of beta-catenin in carcinoma cells .
Author Chigita,S., Sugiura,T., Abe,M., Kobayashi,Y., Shimoda,M., Onoda,M. and Shirasuna,K.
Journal Int. J. Oncol. 41 (6), 2021-2028 (2012)
Title Expression and clinical significance of CD82/KAI1 and E-cadherin in non-small cell lung cancer .
Author Shiwu,W.U., Lan,Y., Wenqing,S., Lei,Z. and Yisheng,T.
Journal Arch Iran Med 15 (11), 707-712 (2012)
Title Utility of immunohistochemical analysis of KAI1, epithelial-specific antigen, and epithelial-related antigen for distinction of chromophobe renal cell carcinoma, an eosinophilic variant from renal oncocytoma .
Author Ohe,C., Kuroda,N., Takasu,K., Senzaki,H., Shikata,N., Yamaguchi,T., Miyasaka,C., Nakano,Y., Sakaida,N. and Uemura,Y.
Journal Med Mol Morphol 45 (2), 98-104 (2012)
Title Expression of CD82 in human trophoblast and its role in trophoblast invasion .
Author Zhang,Q., Tan,D., Luo,W., Lu,J. and Tan,Y.
Journal PLoS ONE 7 (6), E38487 (2012)
Title CsA improves the trophoblasts invasiveness through strengthening the cross-talk of trophoblasts and decidual stromal cells mediated by CXCL12 and CD82 in early pregnancy .
Author Meng,Y.H., Shao,J., Li,H., Hou,Y.L., Tang,C.L., Du,M.R., Li,M.Q. and Li,D.J.
Journal Int J Clin Exp Pathol 5 (4), 299-307 (2012)
Title Molecular analyses of the association of CD4 with two members of the transmembrane 4 superfamily, CD81 and CD82 .
Author Imai,T., Kakizaki,M., Nishimura,M. and Yoshie,O.
Journal J. Immunol. 155 (3), 1229-1239 (1995)
Title KAI1, a metastasis suppressor gene for prostate cancer on human chromosome 11p11.2 .
Author Dong,J.T., Lamb,P.W., Rinker-Schaeffer,C.W., Vukanovic,J., Ichikawa,T., Isaacs,J.T. and Barrett,J.C.
Journal Science 268 (5212), 884-886 (1995)
Title C33 antigen recognized by monoclonal antibodies inhibitory to human .
Author Imai,T., Fukudome,K., Takagi,S., Nagira,M., Furuse,M., Fukuhara,N., Nishimura,M., Hinuma,Y. and Yoshie,O.
Journal J. Immunol. 149 (9), 2879-2886 (1992)
Title Localization of metastasis suppressor gene(s) for prostatic cancer to the short arm of human chromosome 11 .
Author Ichikawa,T., Ichikawa,Y., Dong,J., Hawkins,A.L., Griffin,C.A., Isaacs,W.B., Oshimura,M., Barrett,J.C. and Isaacs,J.T.
Journal Cancer Res. 52 (12), 3486-3490 (1992)
Title Genetic factors and suppression of metastatic ability of prostatic cancer .
Author Ichikawa,T., Ichikawa,Y. and Isaacs,J.T.
Journal Cancer Res. 51 (14), 3788-3792 (1991)
Title A new superfamily of lymphoid and melanoma cell proteins with extensive homology to Schistosoma mansoni antigen Sm23 .
Author Gaugitsch,H.W., Hofer,E., Huber,N.E., Schnabl,E. and Baumruker,T.
Journal Eur. J. Immunol. 21 (2), 377-383 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.