• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens potassium voltage-gated channel, subfamily F, member 1 (KCNF1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu31247 Homo sapiens potassium voltage-gated channel, subfamily F, member 1 (KCNF1), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu31247C Homo sapiens potassium voltage-gated channel, subfamily F, member 1 (KCNF1), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002236.4, 27436998
Length 1485 bp
Structure linear
Update Date 01-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens potassium voltage-gated channel, subfamily F, member 1 (KCNF1), mRNA.
Product potassium voltage-gated channel subfamily F member 1
Comment

Summary: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily F. This gene is intronless and expressed in all tissues tested, including the heart, skeletal muscle, brain, kidney, and pancreas. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BC026110.2 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_002227.2
CDS 491..1975
Misc Feature(1)347..349
Misc Feature(2)563..868
Misc Feature(3)563..868
Misc Feature(4)1040..1102
Misc Feature(5)1160..1222
Misc Feature(6)1163..1696
Misc Feature(7)1238..1300
Misc Feature(8)1358..1420
Misc Feature(9)1463..1525
Misc Feature(10)1481..1690
Misc Feature(11)1598..1615
Misc Feature(12)1646..1708
Exon (1)1..2289
Gene:KCNF1
Gene Synonym:IK8; KCNF; kH1; KV5.1
Translation MDGSGERSLPEPGSQSSAASDDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGY DTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDL KFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCP ARVVAVLSFLLILVSSVVMCMGTIPELQVLDAEGNRVEHPTLENVETACIGWFTLEYLLR LFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARI FKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHPETLFKSIPQS FWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLE TAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLL TEEKHHRTRLQSCK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
68+dbSNP:
68+c, gdbSNP:373451952
159+c, tdbSNP:12617163
568+a, cdbSNP:147760531
577+c, gdbSNP:201712383
594+g, tdbSNP:199875738
598+g, tdbSNP:146949759
641+a, gdbSNP:141961283
662+c, gdbSNP:370503620
679+c, tdbSNP:199646402
706+c, tdbSNP:375600263
738+c, tdbSNP:193920977
790+a, gdbSNP:138975329
805+c, tdbSNP:199752745
862+c, tdbSNP:151111224
879+a, gdbSNP:201047040
880+c, tdbSNP:146303502
944+c, gdbSNP:142872443
946+a, gdbSNP:368995113
949+a, cdbSNP:373432598
958+a, gdbSNP:3732104
1045+c, gdbSNP:374798024
1051+c, gdbSNP:141118481
1139+a, gdbSNP:147777200
1213+c, tdbSNP:141086439
1244+a, gdbSNP:34752664
1267+c, tdbSNP:199507399
1291+c, tdbSNP:114664009
1350+a, gdbSNP:371877225
1354+c, tdbSNP:202046685
1360+a, gdbSNP:367858044
1432+a, cdbSNP:145867221
1476+c, tdbSNP:201163636
1557+a, gdbSNP:1046004
1637+a, gdbSNP:1046005
1651+a, gdbSNP:200755867
1678+c, tdbSNP:3732105
1742+a, gdbSNP:372097411
1750+g, tdbSNP:201734044
1753+c, gdbSNP:144040411
1768+a, gdbSNP:61741190
1798+c, tdbSNP:139764455
1804+c, tdbSNP:377006729
1813+c, gdbSNP:369851909
1826+c, tdbSNP:373365915
1830+a, gdbSNP:199981711
1860+c, tdbSNP:374035056
1861+a, gdbSNP:115526526
complement(1864)-t, cdbSNP:35701651
1872+c, gdbSNP:149685660
1875+c, tdbSNP:140683647
1883+a, gdbSNP:376778174
1933+a, cdbSNP:200816549
1934+g, tdbSNP:138500972
1978+a, gdbSNP:201608690
1979+a, gdbSNP:200541883
1984+c, tdbSNP:137856028
1987+, cdbSNP:35199085
2027+c, tdbSNP:141969545
2120+c, gdbSNP:2602169
2121+c, gdbSNP:2602170
2219+c, tdbSNP:186500057
2220+a, gdbSNP:41264189
2249+a, cdbSNP:145835440
2250+a, gdbSNP:59620674
Gene SymbolKCNF1
Gene SynonymIK8; KCNF; kH1; KV5.1
Chromosome2
Locus Map2p25
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002236 Homo sapiens potassium voltage-gated channel, subfamily F, member 1 (KCNF1), mRNA. On-demand $219.00 7-9
Title International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels .
Author Gutman GA, Chandy KG, Grissmer S, Lazdunski M, McKinnon D, Pardo LA, Robertson GA, Rudy B, Sanguinetti MC, Stuhmer W and Wang X.
Journal Pharmacol. Rev. 57 (4), 473-508 (2005)
Title Obligatory heterotetramerization of three previously uncharacterized Kv channel alpha-subunits identified in the human genome .
Author Ottschytsch N, Raes A, Van Hoorick D and Snyders DJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 99 (12), 7986-7991 (2002)
Title Isolation, characterization, and mapping of two human potassium channels .
Author Su K, Kyaw H, Fan P, Zeng Z, Shell BK, Carter KC and Li Y.
Journal Biochem. Biophys. Res. Commun. 241 (3), 675-681 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.