• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 81 (KRT81), mRNA.


RefSeq Accession Definition Services Price Order
NM_002281 Homo sapiens keratin 81 (KRT81), mRNA. ORF Sequence $440.22
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002281.3, 169790852
Length 1926 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens keratin 81 (KRT81), mRNA.
Product keratin, type II cuticular Hb1
Comment

Summary: The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin, as well as KRTHB3 and KRTHB6, is found primarily in the hair cortex. Mutations in this gene and KRTHB6 have been observed in patients with a rare dominant hair disease, monilethrix. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the bull length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_002272.2
CDS 51..1568
Misc Feature(1)51..368
Misc Feature(2)51..368
Misc Feature(3)363..1298
Misc Feature(4)369..1289
Misc Feature(5)369..473
Misc Feature(6)474..503
Misc Feature(7)504..806
Misc Feature(8)807..857
Misc Feature(9)858..1289
Misc Feature(10)1290..1565
Exon (1)1..419
Gene:KRT81
Gene Synonym:ghHkb1; Hb-1; HB1; hHAKB2-1; KRTHB1; MLN137
Exon (2)420..628
Gene:KRT81
Gene Synonym:ghHkb1; Hb-1; HB1; hHAKB2-1; KRTHB1; MLN137
Exon (3)629..689
Gene:KRT81
Gene Synonym:ghHkb1; Hb-1; HB1; hHAKB2-1; KRTHB1; MLN137
Exon (4)690..785
Gene:KRT81
Gene Synonym:ghHkb1; Hb-1; HB1; hHAKB2-1; KRTHB1; MLN137
Exon (5)786..950
Gene:KRT81
Gene Synonym:ghHkb1; Hb-1; HB1; hHAKB2-1; KRTHB1; MLN137
Exon (6)951..1076
Gene:KRT81
Gene Synonym:ghHkb1; Hb-1; HB1; hHAKB2-1; KRTHB1; MLN137
Exon (7)1077..1297
Gene:KRT81
Gene Synonym:ghHkb1; Hb-1; HB1; hHAKB2-1; KRTHB1; MLN137
Exon (8)1298..1329
Gene:KRT81
Gene Synonym:ghHkb1; Hb-1; HB1; hHAKB2-1; KRTHB1; MLN137
Exon (9)1330..1910
Gene:KRT81
Gene Synonym:ghHkb1; Hb-1; HB1; hHAKB2-1; KRTHB1; MLN137
Translation MTCGSGFGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCG RSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF IDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASEL NHVQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLR RLYEEEILILQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSK CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAA LSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG IGAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNVAVSTGLCAPCGQLNTTCGG GSCGVGSCGISSLGVGSCGSSCRKC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(4)-dbSNP:
complement(4)-g, cdbSNP:200940564
complement(10)-g, adbSNP:189745410
complement(38)-t, cdbSNP:148003777
complement(51)-t, gdbSNP:202023317
complement(72)-t, cdbSNP:183915325
complement(87)-t, gdbSNP:79897879
complement(98)-g, cdbSNP:149101320
complement(110)-g, cdbSNP:75660643
complement(112)-t, cdbSNP:202205489
complement(137)-g, adbSNP:202176338
complement(160)-t, cdbSNP:202217596
complement(187)-g, cdbSNP:201215176
complement(204)-g, cdbSNP:2071588
complement(466)-dbSNP:
complement(466)-t, gdbSNP:201846944
complement(686)-dbSNP:
complement(686)-g, adbSNP:79398941
complement(690)-dbSNP:
complement(690)-t, cdbSNP:145083574
complement(691)-t, adbSNP:149969945
complement(701)-g, adbSNP:140435760
complement(711)-g, cdbSNP:111866984
complement(712)-t, cdbSNP:147886632
complement(716)-t, cdbSNP:141008448
complement(726)-g, cdbSNP:140836779
complement(755)-t, cdbSNP:147285901
complement(771)-g, adbSNP:145562431
complement(772)-t, cdbSNP:148570041
complement(793)-dbSNP:
complement(793)-c, adbSNP:6580873
complement(795)-t, cdbSNP:201895192
complement(803)-t, cdbSNP:149438181
complement(810)-t, cdbSNP:137888857
complement(862)-c, adbSNP:144356330
complement(869)-g, adbSNP:146187254
complement(877)-t, gdbSNP:141587304
complement(896)-t, adbSNP:138597671
complement(912)-g, adbSNP:144716678
complement(923)-g, cdbSNP:200239075
complement(924)-t, cdbSNP:200578000
complement(930)-t, c, adbSNP:140829050
complement(952)-dbSNP:
complement(952)-t, cdbSNP:113592710
complement(971)-t, cdbSNP:138689166
complement(973)-g, adbSNP:202148780
complement(974)-c, adbSNP:148041985
complement(983)-g, adbSNP:143596068
complement(996)-g, adbSNP:4761786
complement(1000)-t, cdbSNP:201504587
complement(1019)-t, cdbSNP:3187034
complement(1030)-t, cdbSNP:147870020
complement(1040)-t, cdbSNP:7300801
complement(1048)-g, adbSNP:34187924
complement(1049)-t, cdbSNP:142386725
complement(1095)-dbSNP:
complement(1095)-t, cdbSNP:201454353
complement(1097)-t, cdbSNP:147690541
complement(1103)-g, adbSNP:4761784
complement(1127)-t, cdbSNP:4761856
complement(1157)-g, adbSNP:150886963
complement(1168)-g, cdbSNP:142439125
complement(1169)-g, adbSNP:140192619
complement(1254)-g, c, adbSNP:56821304
complement(1259)-g, adbSNP:141521550
complement(1273)-t, cdbSNP:201447608
complement(1277)-g, cdbSNP:111382015
complement(1287)-g, adbSNP:57419521
complement(1387)-dbSNP:
complement(1387)-t, cdbSNP:139838048
complement(1413)-c, adbSNP:145963392
complement(1414)-g, adbSNP:201991772
complement(1417)-g, adbSNP:114447073
complement(1430..1431)-, gdbSNP:144562891
complement(1435)-g, adbSNP:74095618
complement(1445)-g, adbSNP:138017582
complement(1485)-t, cdbSNP:150356449
complement(1503)-t, cdbSNP:115355093
complement(1544)-g, adbSNP:200814913
complement(1558)-t, cdbSNP:138935547
complement(1575)-, gdbSNP:201146279
complement(1599)-t, g, c, adbSNP:3657
complement(1670)-g, cdbSNP:3660
complement(1704)-t, gdbSNP:192117741
Gene SymbolKRT81
Gene SynonymghHkb1; Hb-1; HB1; hHAKB2-1; KRTHB1; MLN137
Chromosome12
Locus Map12q13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002281 Homo sapiens keratin 81 (KRT81), mRNA. Full Length $558.54
ORF Sequence $440.22
Title Impact of MiRSNPs on survival and progression in patients with multiple myeloma undergoing autologous stem cell transplantation .
Author de Larrea,C.F., Navarro,A., Tejero,R., Tovar,N., Diaz,T., Cibeira,M.T., Rosinol,L., Ferrer,G., Rovira,M., Rozman,M., Monzo,M. and Blade,J.
Journal Clin. Cancer Res. 18 (13), 3697-3704 (2012)
Title A dual role for KRT81: a miR-SNP associated with recurrence in non-small-cell lung cancer and a novel marker of squamous cell lung carcinoma .
Author Campayo,M., Navarro,A., Vinolas,N., Tejero,R., Munoz,C., Diaz,T., Marrades,R., Cabanas,M.L., Gimferrer,J.M., Gascon,P., Ramirez,J. and Monzo,M.
Journal PLoS ONE 6 (7), E22509 (2011)
Title Transcriptional activation of a subset of hair keratin genes by the NF-kappaB effector p65/RelA .
Author Gilon,M., Sher,N., Cohen,S. and Gat,U.
Journal Differentiation 76 (5), 518-530 (2008)
Title New consensus nomenclature for mammalian keratins .
Author Schweizer,J., Bowden,P.E., Coulombe,P.A., Langbein,L., Lane,E.B., Magin,T.M., Maltais,L., Omary,M.B., Parry,D.A., Rogers,M.A. and Wright,M.W.
Journal J. Cell Biol. 174 (2), 169-174 (2006)
Title Keratins of the human hair follicle .
Author Langbein,L. and Schweizer,J.
Journal Int. Rev. Cytol. 243, 1-78 (2005)
Title A variable monilethrix phenotype associated with a novel mutation, Glu402Lys, in the helix termination motif of the type II hair keratin hHb1 .
Author Winter,H., Labreze,C., Chapalain,V., Surleve-Bazeille,J.E., Mercier,M., Rogers,M.A., Taieb,A. and Schweizer,J.
Journal J. Invest. Dermatol. 111 (1), 169-172 (1998)
Title Characterization and chromosomal localization of human hair-specific keratin genes and comparative expression during the hair growth cycle .
Author Bowden,P.E., Hainey,S.D., Parker,G., Jones,D.O., Zimonjic,D., Popescu,N. and Hodgins,M.B.
Journal J. Invest. Dermatol. 110 (2), 158-164 (1998)
Title A new mutation in the type II hair cortex keratin hHb1 involved in the inherited hair disorder monilethrix .
Author Winter,H., Rogers,M.A., Gebhardt,M., Wollina,U., Boxall,L., Chitayat,D., Babul-Hirji,R., Stevens,H.P., Zlotogorski,A. and Schweizer,J.
Journal Hum. Genet. 101 (2), 165-169 (1997)
Title Sequence data and chromosomal localization of human type I and type .
Author Rogers,M.A., Nischt,R., Korge,B., Krieg,T., Fink,T.M., Lichter,P., Winter,H. and Schweizer,J.
Journal Exp. Cell Res. 220 (2), 357-362 (1995)
Title Sequence and expression of human hair keratin genes .
Author Bowden,P.E., Hainey,S., Parker,G. and Hodgins,M.B.
Journal J. Dermatol. Sci. 7 (SUPPL), S152-S163 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878