• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 83 (KRT83), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002282 Homo sapiens keratin 83 (KRT83), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_002282.3, 169790840
Length 1875 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens keratin 83 (KRT83), mRNA.
Product keratin, type II cuticular Hb3
Comment

Summary: The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin, as well as KRTHB1 and KRTHB6, is found primarily in the hair cortex. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.


##Evidence-Data-START## Transcript exon combination :: X99141.1, BC128063.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025082, ERS025084 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_002273.3
CDS 64..1545
Misc Feature(1)64..396
Misc Feature(2)64..396
Misc Feature(3)391..1326
Misc Feature(4)397..1317
Misc Feature(5)397..501
Misc Feature(6)502..531
Misc Feature(7)532..834
Misc Feature(8)835..885
Misc Feature(9)886..1317
Misc Feature(10)1318..1542
Exon (1)1..447
Gene:KRT83
Gene Synonym:Hb-3; HB3; KRTHB3
Exon (2)448..656
Gene:KRT83
Gene Synonym:Hb-3; HB3; KRTHB3
Exon (3)657..717
Gene:KRT83
Gene Synonym:Hb-3; HB3; KRTHB3
Exon (4)718..813
Gene:KRT83
Gene Synonym:Hb-3; HB3; KRTHB3
Exon (5)814..978
Gene:KRT83
Gene Synonym:Hb-3; HB3; KRTHB3
Exon (6)979..1104
Gene:KRT83
Gene Synonym:Hb-3; HB3; KRTHB3
Exon (7)1105..1325
Gene:KRT83
Gene Synonym:Hb-3; HB3; KRTHB3
Exon (8)1326..1357
Gene:KRT83
Gene Synonym:Hb-3; HB3; KRTHB3
Exon (9)1358..1875
Gene:KRT83
Gene Synonym:Hb-3; HB3; KRTHB3
Translation MTCGFNSIGCGFRPGNFSCVSACGPRPSRCCITAAPYRGISCYRGLTGGFGSHSVCGGFR AGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNS RFAAFIDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFAGYIETLRREAECVEADSGR LASELNHVQEVLEGYKKKYEEEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALIQE IDFLRRLYEEEIRILQSHISDTSVVVKLDNSRDLNMDCIVAEIKAQYDDIATRSRAEAES WYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQ QGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQ RLCEGVEAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNLVVSTGLCKPCGQLN TTCGGGSCGQGRH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(56)-t, gdbSNP:200214916
complement(101)-c, adbSNP:149947658
complement(130)-c, adbSNP:61485872
complement(136)-g, adbSNP:146287955
complement(142)-t, gdbSNP:200833070
complement(159)-g, adbSNP:201594412
complement(241)-g, adbSNP:141964696
complement(255)-t, gdbSNP:199997738
complement(267)-g, adbSNP:148290789
complement(285)-g, adbSNP:138833898
complement(302)-g, adbSNP:150875897
complement(354)-g, adbSNP:150640038
complement(363)-t, gdbSNP:141906513
complement(374)-g, adbSNP:201909879
complement(375)-t, cdbSNP:111267865
complement(382)-t, cdbSNP:143776387
complement(391)-c, adbSNP:201373391
complement(426)-t, cdbSNP:143269537
complement(432)-t, cdbSNP:200595102
complement(452)-dbSNP:
complement(452)-t, cdbSNP:139360978
complement(458)-g, adbSNP:146915800
complement(508)-t, cdbSNP:2857663
complement(511)-t, cdbSNP:200073682
complement(515)-t, cdbSNP:201680950
complement(536)-t, gdbSNP:145476924
complement(543)-g, adbSNP:11834565
complement(548)-t, cdbSNP:140783754
complement(560)-g, cdbSNP:200690744
complement(577)-t, g, cdbSNP:140443749
complement(583)-t, cdbSNP:181439241
complement(588)-t, cdbSNP:150975843
complement(621)-t, cdbSNP:3741715
complement(625)-t, cdbSNP:138611799
complement(647)-t, cdbSNP:201851696
complement(664)-dbSNP:
complement(664)-c, adbSNP:146753414
complement(668..670)-, cttdbSNP:149269323
complement(668)-t, adbSNP:77331319
complement(669)-, ttcdbSNP:74773270
complement(686)-g, adbSNP:143530888
complement(696)-g, adbSNP:140012906
complement(724..725)-dbSNP:
complement(724..725)-, cdbSNP:35353807
complement(729)-t, c, adbSNP:2857667
complement(730)-t, cdbSNP:149581248
complement(739)-g, adbSNP:192947508
complement(762)-g, adbSNP:186866078
complement(820)-dbSNP:
complement(820)-g, adbSNP:202171422
complement(821)-t, cdbSNP:139308736
complement(823)-t, cdbSNP:150867374
complement(831)-t, cdbSNP:143202217
complement(838)-t, cdbSNP:139293379
complement(853)-t, cdbSNP:201459857
complement(864)-g, cdbSNP:200304640
complement(879)-t, cdbSNP:146898919
complement(891)-t, cdbSNP:200274404
complement(900)-g, cdbSNP:2852464
complement(906)-t, cdbSNP:2857669
complement(940)-g, adbSNP:143037477
complement(941)-t, cdbSNP:149046299
complement(958)-t, cdbSNP:201760909
complement(970)-g, adbSNP:144951378
complement(978)-t, cdbSNP:200275142
complement(1008)-dbSNP:
complement(1008)-t, cdbSNP:138807826
complement(1024)-g, adbSNP:200128355
complement(1025)-t, cdbSNP:201828918
complement(1027)-g, adbSNP:145387028
complement(1047)-g, adbSNP:2257286
complement(1058)-t, cdbSNP:146734638
complement(1077)-t, cdbSNP:202206430
complement(1080)-g, adbSNP:143467763
complement(1119)-dbSNP:
complement(1119)-t, cdbSNP:2248473
complement(1122)-t, cdbSNP:2852468
complement(1147)-t, cdbSNP:140635030
complement(1155)-t, cdbSNP:200684354
complement(1197)-g, adbSNP:148519033
complement(1198)-g, cdbSNP:201054359
complement(1226)-g, adbSNP:144732230
complement(1256)-g, adbSNP:151316742
complement(1266)-t, cdbSNP:199719454
complement(1282)-g, adbSNP:57802288
complement(1302)-g, adbSNP:143142877
complement(1314)-g, adbSNP:140907551
complement(1331)-dbSNP:
complement(1331)-g, cdbSNP:148757217
complement(1349)-t, adbSNP:191425339
complement(1390)-dbSNP:
complement(1390)-t, cdbSNP:144061807
complement(1395)-t, cdbSNP:2857670
complement(1400)-t, cdbSNP:150498347
complement(1401)-g, adbSNP:11836080
complement(1431)-t, g, adbSNP:147993280
complement(1443)-g, adbSNP:145323146
complement(1475)-t, cdbSNP:147359482
complement(1486)-g, adbSNP:200232339
complement(1540)-t, cdbSNP:2857671
complement(1547)-g, adbSNP:190585205
complement(1589)-g, adbSNP:186532103
complement(1683)-t, cdbSNP:2857672
complement(1719)-g, adbSNP:2852456
complement(1835)-t, cdbSNP:114956210
complement(1866)-c, adbSNP:199721779
complement(1869)-, cdbSNP:11285858
Gene SymbolKRT83
Gene SynonymHb-3; HB3; KRTHB3
Chromosome12
Locus Map12q13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002282 Homo sapiens keratin 83 (KRT83), mRNA. On-demand $699.00 18
XM_003846559 PREDICTED: Homo sapiens keratin 83, transcript variant 1 (KRT83), mRNA. On-demand $699.00 18
XM_003846560 PREDICTED: Homo sapiens keratin 83, transcript variant 2 (KRT83), mRNA. On-demand $699.00 18
Title New consensus nomenclature for mammalian keratins .
Author Schweizer,J., Bowden,P.E., Coulombe,P.A., Langbein,L., Lane,E.B., Magin,T.M., Maltais,L., Omary,M.B., Parry,D.A., Rogers,M.A. and Wright,M.W.
Journal J. Cell Biol. 174 (2), 169-174 (2006)
Title A missense mutation in the type II hair keratin hHb3 is associated with monilethrix .
Author van Steensel,M.A., Steijlen,P.M., Bladergroen,R.S., Vermeer,M. and van Geel,M.
Journal J. Med. Genet. 42 (3), E19 (2005)
Title Keratins of the human hair follicle .
Author Langbein,L. and Schweizer,J.
Journal Int. Rev. Cytol. 243, 1-78 (2005)
Title The catalog of human hair keratins. II. Expression of the six type .
Author Langbein,L., Rogers,M.A., Winter,H., Praetzel,S. and Schweizer,J.
Journal J. Biol. Chem. 276 (37), 35123-35132 (2001)
Title Characterization of a 300 kbp region of human DNA containing the type II hair keratin gene domain .
Author Rogers,M.A., Winter,H., Langbein,L., Wolf,C. and Schweizer,J.
Journal J. Invest. Dermatol. 114 (3), 464-472 (2000)
Title Sequences and differential expression of three novel human type-II hair keratins .
Author Rogers,M.A., Langbein,L., Praetzel,S., Moll,I., Krieg,T., Winter,H. and Schweizer,J.
Journal Differentiation 61 (3), 187-194 (1997)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.