• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens laminin, beta 2 (laminin S) (LAMB2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu17891 Homo sapiens laminin, beta 2 (laminin S) (LAMB2), mRNA. pcDNA3.1+-DYK On-demand $2699.00 30
OHu17891C Homo sapiens laminin, beta 2 (laminin S) (LAMB2), mRNA. Customized vector On-demand $2699.00 30

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002292.3, 119703754
Length 5397 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens laminin, beta 2 (laminin S) (LAMB2), mRNA.
Product laminin subunit beta-2 precursor
Comment

Summary: Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins, composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively), form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the beta chain isoform laminin, beta 2. The beta 2 chain contains the 7 structural domains typical of beta chains of laminin, including the short alpha region. However, unlike beta 1 chain, beta 2 has a more restricted tissue distribution. It is enriched in the basement membrane of muscles at the neuromuscular junctions, kidney glomerulus and vascular smooth muscle. Transgenic mice in which the beta 2 chain gene was inactivated by homologous recombination, showed defects in the maturation of neuromuscular junctions and impairment of glomerular filtration. Alternative splicing involving a non consensus 5' splice site (gc) in the 5' UTR of this gene has been reported. It was suggested that inefficient splicing of this first intron, which does not change the protein sequence, results in a greater abundance of the unspliced form of the transcript than the spliced form. The full-length nature of the spliced transcript is not known. [provided by RefSeq, Aug 2011].

RefSeq NP_002283.3
CDS 300..5696
Misc Feature(1)213..298
Misc Feature(2)438..1142
Misc Feature(3)1146..1304
Misc Feature(4)order(1146..1148,1152..1154,1173..1175,1227..1229,
Misc Feature(5)1338..1496
Misc Feature(6)order(1338..1340,1344..1346,1365..1367,1419..1421,
Misc Feature(7)1524..1703
Misc Feature(8)order(1527..1529,1533..1535,1566..1568,1611..1613,
Misc Feature(9)1704..1859
Misc Feature(10)order(1707..1709,1713..1715,1749..1751,1770..1772,
Misc Feature(11)1860..1985
Misc Feature(12)order(1863..1865,1869..1871,1899..1901,1920..1922,
Misc Feature(13)2643..2786
Misc Feature(14)order(2646..2648,2652..2654,2682..2684,2703..2705,
Misc Feature(15)2787..2918
Misc Feature(16)order(2790..2792,2796..2798,2826..2828,2847..2849,
Misc Feature(17)2925..3062
Misc Feature(18)order(2928..2930,2934..2936,2955..2957,2976..2978,
Misc Feature(19)3075..3251
Misc Feature(20)order(3078..3080,3084..3086,3126..3128,3159..3161,
Misc Feature(21)3255..3395
Misc Feature(22)order(3255..3257,3261..3263,3297..3299,3318..3320,
Misc Feature(23)3408..3578
Misc Feature(24)order(3411..3413,3417..3419,3447..3449,3492..3494,
Misc Feature(25)3579..3707
Misc Feature(26)order(3582..3584,3588..3590,3618..3620,3639..3641,
Misc Feature(27)3723..3872
Misc Feature(28)order(3726..3728,3732..3734,3762..3764,3783..3785,
Misc Feature(29)3867..4526
Misc Feature(30)4527..4625
Misc Feature(31)4626..5693
Misc Feature(32)<4626..4850
Misc Feature(33)4632..5402
Misc Feature(34)4746..5309
Misc Feature(35)<5358..5618
Exon (1)1..375
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (2)376..548
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (3)549..684
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (4)685..758
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (5)759..947
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (6)948..1011
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (7)1012..1214
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (8)1215..1335
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (9)1336..1524
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (10)1525..1704
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (11)1705..1817
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (12)1818..1897
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (13)1898..2030
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (14)2031..2189
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (15)2190..2317
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (16)2318..2450
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (17)2451..2643
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (18)2644..2787
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (19)2788..3019
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (20)3020..3183
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (21)3184..3408
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (22)3409..3626
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (23)3627..3723
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (24)3724..4096
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (25)4097..4281
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (26)4282..4523
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (27)4524..4872
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (28)4873..5080
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (29)5081..5222
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (30)5223..5399
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (31)5400..5559
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Exon (32)5560..5808
Gene:LAMB2
Gene Synonym:LAMS; NPHS5
Translation MELTSRERGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA HAEGMVHGACICKHNTRGLNCEQCQDFYRDLPWRPAEDGHSHACRKCECHGHTHSCHFDM AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDRLGCRRCQCNARGTVPG STPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEGTGQ CHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV RLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGHLVPK DDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVL LPRVLVLEMFSGGDAAALERQATFERYQCHEEGLVPSKTSPSEACAPLLISLSTLIYNGA LPCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALS SLCEKTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHT GGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHQDEYSQQIVCHCRAGY TGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCA HCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCA PNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQC HACDCDSRGIDTPQCHRFTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRV VQDLAARTQRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVE ATEELRREIGEATEHLTQLEADLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDL LKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFN SKHMANQRALGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL SCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA SRGQVEQANQELQELIQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA ERVRSLADVDAILARTVGDVRRAEQLLQDARRARSWAEDEKQKAETVQAALEEAQRAQGI AQGAIRGAVADTRDTEQTLYQVQERMAGAERALSSAGERARQLDALLEALKLKRAGNSLA ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARD LLQAAQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(153)-dbSNP:
complement(153)-g, cdbSNP:370936732
complement(171)-t, adbSNP:7428401
complement(262)-t, adbSNP:111879332
complement(266)-g, adbSNP:201768942
complement(289)-g, adbSNP:367949497
complement(297)-t, cdbSNP:370406697
complement(307)-g, adbSNP:373955878
complement(330)-t, cdbSNP:148776956
complement(374)-g, adbSNP:146112267
complement(398)-dbSNP:
complement(398)-t, cdbSNP:371368445
complement(399)-c, adbSNP:138554079
complement(400)-t, gdbSNP:202057459
complement(408)-g, cdbSNP:144765752
416+c, gdbSNP:1131779
complement(488)-g, adbSNP:200171185
517+c, gdbSNP:1131780
complement(533)-g, adbSNP:201179067
complement(552)-dbSNP:
complement(552)-t, cdbSNP:140371771
complement(560)-t, g, cdbSNP:149408554
complement(583)-t, cdbSNP:147691227
complement(605)-g, c, adbSNP:79448908
613+c, gdbSNP:1131781
complement(619)-t, cdbSNP:369040269
665+c, tdbSNP:1131782
678+c, gdbSNP:1131783
complement(689)-dbSNP:
complement(689)-t, gdbSNP:372208669
complement(707)-g, cdbSNP:7426606
complement(728..729)-, adbSNP:34137056
739+a, gdbSNP:387906644
785+dbSNP:
785+c, gdbSNP:1131784
complement(809)-g, adbSNP:149856537
complement(812)-g, adbSNP:367900776
840+c, gdbSNP:1131785
complement(842)-g, adbSNP:146123324
complement(878)-g, adbSNP:373908790
complement(880)-g, cdbSNP:139885683
complement(882)-g, adbSNP:147986864
complement(897)-t, cdbSNP:149325182
complement(900)-t, cdbSNP:372216542
complement(919)-g, adbSNP:138927110
933+a, gdbSNP:78396660
complement(945)-t, cdbSNP:368339529
complement(950)-dbSNP:
complement(950)-g, adbSNP:200502128
complement(974..975)-, gdbSNP:36033820
complement(990)-g, adbSNP:142153730
complement(995)-g, adbSNP:183480534
complement(997)-c, adbSNP:200533784
complement(1002)-g, adbSNP:144133177
complement(1016)-dbSNP:
complement(1016)-g, cdbSNP:371236878
1035+c, tdbSNP:121912488
1036+a, gdbSNP:121912491
complement(1061)-t, cdbSNP:201406827
complement(1086)-g, adbSNP:200316162
complement(1091)-t, cdbSNP:201989742
complement(1094)-t, cdbSNP:375953746
complement(1115)-g, adbSNP:151251039
complement(1163)-g, adbSNP:141473567
complement(1208)-t, cdbSNP:372432021
complement(1213)-g, adbSNP:199794467
complement(1244)-dbSNP:
complement(1244)-g, adbSNP:374533669
complement(1248)-t, gdbSNP:139670781
complement(1249)-t, cdbSNP:144771072
1260+c, tdbSNP:121912492
complement(1263)-t, cdbSNP:201043820
complement(1299)-t, gdbSNP:187004232
complement(1304)-t, cdbSNP:370372042
complement(1313)-g, adbSNP:150731491
complement(1314)-g, cdbSNP:376294474
complement(1334)-, cdbSNP:34313942
1346+dbSNP:
1346+c, gdbSNP:1131786
complement(1353..1354)-, gdbSNP:146665553
complement(1383)-t, cdbSNP:369642882
complement(1388)-g, adbSNP:369179408
1421+a, tdbSNP:121912490
complement(1425)-t, cdbSNP:138965154
complement(1453)-t, cdbSNP:376892699
complement(1468)-t, cdbSNP:151276385
complement(1492)-g, adbSNP:77500937
complement(1500)-g, cdbSNP:148956392
complement(1504)-t, cdbSNP:150202979
complement(1505)-t, cdbSNP:201999373
complement(1556)-dbSNP:
complement(1556)-g, adbSNP:146643686
complement(1576)-t, gdbSNP:367947002
complement(1604)-g, adbSNP:144530798
complement(1605)-t, cdbSNP:142402808
complement(1626)-g, adbSNP:200732790
1628+c, tdbSNP:1131787
complement(1682)-g, adbSNP:373952285
complement(1690)-t, cdbSNP:188487818
complement(1721)-dbSNP:
complement(1721)-t, gdbSNP:201408584
complement(1722)-g, adbSNP:144487632
complement(1723)-t, cdbSNP:370565848
complement(1741)-t, cdbSNP:144230655
complement(1797)-g, adbSNP:199518288
complement(1818)-dbSNP:
complement(1818)-g, adbSNP:143741714
1840+a, tdbSNP:1131788
complement(1841)-g, adbSNP:150783390
complement(1857)-g, adbSNP:36050330
complement(1858)-t, cdbSNP:148333147
complement(1862)-g, adbSNP:142831884
complement(1871)-g, adbSNP:111883392
complement(1872)-t, cdbSNP:200694459
complement(1874)-g, adbSNP:138230622
complement(1875)-t, cdbSNP:370976756
complement(1933)-dbSNP:
complement(1933)-t, gdbSNP:377519693
2016+a, gdbSNP:1131789
complement(2016)-g, adbSNP:386518050
complement(2023)-t, cdbSNP:61729152
complement(2027)-t, cdbSNP:372514590
complement(2049)-dbSNP:
complement(2049)-t, gdbSNP:369408727
complement(2055)-t, cdbSNP:145578530
complement(2061)-g, cdbSNP:144324168
complement(2063)-g, adbSNP:33942096
complement(2064)-t, cdbSNP:369793777
complement(2066)-t, cdbSNP:112239102
complement(2096)-g, adbSNP:376785056
2102+a, gdbSNP:1131790
2150+a, c, gdbSNP:1131791
2153+g, tdbSNP:1131792
complement(2154)-t, cdbSNP:367670275
complement(2161)-t, cdbSNP:373861923
complement(2171)-c, adbSNP:199859609
complement(2185)-g, adbSNP:148491867
complement(2186)-t, gdbSNP:371481972
complement(2230)-dbSNP:
complement(2230)-t, cdbSNP:200738080
2278+a, gdbSNP:1131793
complement(2328)-dbSNP:
complement(2328)-g, adbSNP:373260991
complement(2352)-g, adbSNP:201625807
complement(2364)-g, adbSNP:374219545
2366+c, gdbSNP:121912489
complement(2388)-g, adbSNP:149304508
complement(2391)-t, cdbSNP:369063535
complement(2394)-g, cdbSNP:28364667
complement(2398)-t, cdbSNP:142860588
complement(2443)-g, adbSNP:374634993
complement(2449)-g, adbSNP:374417189
complement(2466)-dbSNP:
complement(2466)-g, adbSNP:145660751
complement(2485)-t, adbSNP:376660822
complement(2535)-g, adbSNP:200658738
complement(2536)-t, cdbSNP:141407145
complement(2570)-t, gdbSNP:143405268
complement(2594)-g, adbSNP:201289156
complement(2602)-c, adbSNP:201787050
complement(2606)-g, adbSNP:147076626
complement(2621)-g, cdbSNP:142116851
complement(2635)-c, adbSNP:200858061
complement(2643)-t, g, adbSNP:199837675
complement(2707)-dbSNP:
complement(2707)-g, adbSNP:200477330
complement(2719)-c, adbSNP:200740666
complement(2731)-t, cdbSNP:201223945
complement(2733)-g, adbSNP:151134957
2743+g, tdbSNP:1131795
complement(2749)-g, adbSNP:368457196
complement(2782)-g, cdbSNP:376033769
complement(2814)-dbSNP:
complement(2814)-g, adbSNP:373694628
complement(2876)-g, adbSNP:139643313
complement(2885)-g, adbSNP:375968729
complement(2887)-t, cdbSNP:146326783
complement(2925)-g, adbSNP:200108816
complement(2940)-t, cdbSNP:370603286
complement(2959)-t, adbSNP:376553423
complement(2971)-t, cdbSNP:372492964
complement(2972)-g, adbSNP:144092322
complement(2973)-t, cdbSNP:376290063
complement(2989)-t, cdbSNP:375392013
2995+a, tdbSNP:1131796
complement(3023)-dbSNP:
complement(3023)-g, adbSNP:142012138
complement(3025)-g, adbSNP:201756319
complement(3026)-g, adbSNP:376904255
complement(3039)-t, cdbSNP:35713889
complement(3049)-t, cdbSNP:200586104
complement(3072)-g, adbSNP:190191113
complement(3094)-, cdbSNP:35590221
complement(3109)-t, cdbSNP:201235061
complement(3153)-t, adbSNP:146962414
complement(3168)-g, adbSNP:372148651
3215+dbSNP:
3215+c, gdbSNP:1131797
complement(3221)-g, cdbSNP:145465720
complement(3222)-t, cdbSNP:370271440
complement(3244)-t, cdbSNP:149653966
complement(3258)-t, cdbSNP:34759087
complement(3260)-g, cdbSNP:146232955
complement(3274)-g, adbSNP:148732023
3305+a, cdbSNP:1131798
complement(3312)-t, cdbSNP:373146572
complement(3369)-g, cdbSNP:201823350
complement(3370)-g, adbSNP:368506627
3395+a, gdbSNP:1131799
complement(3408)-g, adbSNP:201159870
complement(3410)-dbSNP:
complement(3410)-t, gdbSNP:377001423
complement(3411)-g, adbSNP:200802954
complement(3417)-t, adbSNP:149560677
complement(3440)-t, cdbSNP:373002075
complement(3506)-g, adbSNP:377452734
complement(3531)-g, adbSNP:143284092
complement(3532)-t, cdbSNP:373712709
complement(3572)-g, adbSNP:369406683
3592+a, tdbSNP:1131800
complement(3593)-g, adbSNP:376981766
complement(3600)-g, adbSNP:150234642
complement(3601)-t, cdbSNP:140199337
complement(3624)-t, cdbSNP:79677861
complement(3629)-dbSNP:
complement(3629)-g, cdbSNP:145578707
complement(3648)-g, adbSNP:149719225
complement(3649)-g, cdbSNP:139821983
complement(3654)-t, cdbSNP:199570781
complement(3667)-t, cdbSNP:368064595
complement(3674)-g, adbSNP:139893128
complement(3686)-t, cdbSNP:34290943
complement(3742)-dbSNP:
complement(3742)-t, cdbSNP:138774635
complement(3793)-t, cdbSNP:374189761
complement(3797)-t, cdbSNP:186771094
complement(3801)-, cdbSNP:34824322
complement(3846)-t, cdbSNP:370877359
complement(3852)-g, c, adbSNP:112650935
complement(3864)-g, adbSNP:377387427
complement(3873)-c, adbSNP:374537156
complement(3881)-g, adbSNP:138540017
complement(3882)-t, cdbSNP:137888590
complement(3897)-g, cdbSNP:200960013
complement(3918)-g, adbSNP:372032732
complement(3940)-t, cdbSNP:202135107
complement(3943)-g, adbSNP:140456179
complement(3944)-t, cdbSNP:13082063
complement(3944)-t, cdbSNP:386527017
complement(3970)-g, adbSNP:376037354
complement(3973)-t, cdbSNP:150013302
complement(3999)-t, cdbSNP:147877286
complement(4041)-g, adbSNP:372230106
complement(4056)-t, cdbSNP:141062242
complement(4078)-t, gdbSNP:199978262
complement(4096)-t, cdbSNP:201247413
complement(4099)-dbSNP:
complement(4099)-t, cdbSNP:141988617
complement(4109)-t, cdbSNP:144765123
complement(4150)-g, adbSNP:183898563
complement(4157)-c, adbSNP:34967349
complement(4169)-g, adbSNP:138665073
complement(4174)-t, adbSNP:148246465
complement(4204)-t, cdbSNP:377447389
complement(4226)-g, cdbSNP:148036130
complement(4269)-c, adbSNP:370213357
complement(4271)-t, gdbSNP:370918360
complement(4299)-dbSNP:
complement(4299)-g, adbSNP:192608928
complement(4300)-t, cdbSNP:144783830
complement(4304)-g, adbSNP:199510279
complement(4333)-t, cdbSNP:75073433
complement(4336)-t, cdbSNP:149144377
complement(4360)-g, adbSNP:200921264
complement(4363)-g, adbSNP:201104040
complement(4369)-g, adbSNP:141074838
complement(4393)-t, cdbSNP:375964293
complement(4396)-t, cdbSNP:201519651
complement(4412)-t, cdbSNP:371701569
complement(4417)-t, cdbSNP:112933248
complement(4438)-t, cdbSNP:372463037
4439+a, cdbSNP:267607207
complement(4448)-t, gdbSNP:150064487
complement(4461)-g, adbSNP:143790783
complement(4462)-t, cdbSNP:146522641
4476+c, tdbSNP:267607208
complement(4521)-g, adbSNP:143974640
complement(4556)-dbSNP:
complement(4556)-g, adbSNP:149536828
complement(4569)-t, cdbSNP:146994050
complement(4573)-g, cdbSNP:141317511
complement(4577)-g, adbSNP:377154999
complement(4603)-g, adbSNP:140968382
complement(4604)-t, cdbSNP:371257983
complement(4605)-g, adbSNP:200127858
complement(4606)-t, cdbSNP:377526198
complement(4640)-g, adbSNP:370815324
complement(4646)-t, gdbSNP:202083663
complement(4655)-t, adbSNP:370382927
complement(4668)-g, adbSNP:151037751
complement(4669)-t, cdbSNP:148818522
complement(4694)-t, cdbSNP:146874007
complement(4724)-g, adbSNP:140142444
complement(4737)-t, cdbSNP:146110649
complement(4740)-g, adbSNP:139490252
complement(4752)-t, cdbSNP:377340882
complement(4781)-g, adbSNP:199894011
complement(4858)-t, cdbSNP:148069401
complement(4867)-t, adbSNP:142857248
complement(4872)-g, adbSNP:376983109
complement(4897)-dbSNP:
complement(4897)-g, adbSNP:114371735
complement(4913)-t, cdbSNP:372405688
4970+c, tdbSNP:3209614
complement(4982)-c, adbSNP:145478482
complement(4990)-t, cdbSNP:367671665
complement(4993)-c, adbSNP:373872524
complement(5011)-g, adbSNP:371490301
complement(5021)-t, cdbSNP:371619654
complement(5027)-g, adbSNP:145910148
complement(5040)-g, adbSNP:374187759
complement(5041)-t, cdbSNP:149601073
complement(5044)-t, cdbSNP:376911922
complement(5071)-t, cdbSNP:201829186
complement(5073)-g, adbSNP:61729458
complement(5083)-dbSNP:
complement(5083)-t, cdbSNP:145169275
complement(5177)-t, cdbSNP:148648480
complement(5187)-t, cdbSNP:144938183
complement(5197)-t, cdbSNP:149690378
complement(5227)-dbSNP:
complement(5227)-t, cdbSNP:201844235
complement(5234)-t, cdbSNP:112826662
complement(5238)-t, cdbSNP:147341948
complement(5239)-g, adbSNP:374665402
complement(5250)-g, adbSNP:200165604
complement(5251)-t, cdbSNP:142896683
complement(5257)-g, adbSNP:200761921
complement(5281)-t, cdbSNP:201886086
complement(5282)-g, cdbSNP:147203507
complement(5286)-g, adbSNP:371375999
complement(5291)-g, adbSNP:371816688
complement(5294)-g, adbSNP:112981471
complement(5297)-g, adbSNP:143723352
complement(5319)-g, adbSNP:138816491
complement(5325)-t, cdbSNP:200747448
complement(5326)-c, adbSNP:199580679
complement(5338)-g, adbSNP:141473691
complement(5360)-t, cdbSNP:150465100
complement(5408)-dbSNP:
complement(5408)-g, adbSNP:151292828
complement(5414)-g, adbSNP:28612476
complement(5441)-t, cdbSNP:139511264
complement(5443)-g, adbSNP:144194438
complement(5454)-g, adbSNP:201458234
complement(5465)-t, cdbSNP:114485284
complement(5512)-g, adbSNP:139156815
5517+a, gdbSNP:3192123
complement(5523)-g, adbSNP:201704175
complement(5532)-t, cdbSNP:142041381
complement(5592)-dbSNP:
complement(5592)-t, g, cdbSNP:74951356
complement(5595)-t, gdbSNP:200137625
complement(5648)-t, cdbSNP:193202109
complement(5678)-g, c, adbSNP:11550620
complement(5685)-t, gdbSNP:200838685
complement(5716)-g, cdbSNP:368990727
complement(5742)-t, gdbSNP:370642328
complement(5808)-t, c, adbSNP:112615532
complement(5808)-g, adbSNP:386421027
Gene SymbolLAMB2
Gene SynonymLAMS; NPHS5
Chromosome3
Locus Map3p21
Title A novel mutation of LAMB2 in a multigenerational mennonite family reveals a new phenotypic variant of Pierson syndrome .
Author Mohney BG, Pulido JS, Lindor NM, Hogan MC, Consugar MB, Peters J, Pankratz VS, Nasr SH, Smith SJ, Gloor J, Kubly V, Spencer D, Nielson R, Puffenberger EG, Strauss KA, Morton DH, Eldahdah L and Harris PC.
Journal Ophthalmology 118 (6), 1137-1144 (2011)
Title Novel mutations in steroid-resistant nephrotic syndrome diagnosed in Tunisian children .
Author Mbarek IB, Abroug S, Omezzine A, Pawtowski A, Gubler MC, Bouslama A, Harbi A and Antignac C.
Journal Pediatr. Nephrol. 26 (2), 241-249 (2011)
Title Mutations in the human laminin beta2 (LAMB2) gene and the associated phenotypic spectrum .
Author Matejas V, Hinkes B, Alkandari F, Al-Gazali L, Annexstad E, Aytac MB, Barrow M, Blahova K, Bockenhauer D, Cheong HI, Maruniak-Chudek I, Cochat P, Dotsch J, Gajjar P, Hennekam RC, Janssen F, Kagan M, Kariminejad A, Kemper MJ, Koenig J, Kogan J, Kroes HY, Kuwertz-Broking E, Lewanda AF, Medeira A, Muscheites J, Niaudet P, Pierson M, Saggar A, Seaver L, Suri M, Tsygin A, Wuhl E, Zurowska A, Uebe S, Hildebrandt F, Antignac C and Zenker M.
Journal Hum. Mutat. 31 (9), 992-1002 (2010)
Title Genotype-phenotype correlations in non-Finnish congenital nephrotic syndrome .
Author Machuca E, Benoit G, Nevo F, Tete MJ, Gribouval O, Pawtowski A, Brandstrom P, Loirat C, Niaudet P, Gubler MC and Antignac C.
Journal J. Am. Soc. Nephrol. 21 (7), 1209-1217 (2010)
Title Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population .
Author So HC, Fong PY, Chen RY, Hui TC, Ng MY, Cherny SS, Mak WW, Cheung EF, Chan RC, Chen EY, Li T and Sham PC.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 153B (1), 103-113 (2010)
Title The human laminin beta 2 chain (S-laminin): structure, expression in fetal tissues and chromosomal assignment of the LAMB2 gene .
Author Iivanainen A, Vuolteenaho R, Sainio K, Eddy R, Shows TB, Sariola H and Tryggvason K.
Journal Matrix Biol. 14 (6), 489-497 (1995)
Title Human beta 2 chain of laminin (formerly S chain): cDNA cloning, chromosomal localization, and expression in carcinomas .
Author Wewer UM, Gerecke DR, Durkin ME, Kurtz KS, Mattei MG, Champliaud MF, Burgeson RE and Albrechtsen R.
Journal Genomics 24 (2), 243-252 (1994)
Title A new nomenclature for the laminins .
Author Burgeson RE, Chiquet M, Deutzmann R, Ekblom P, Engel J, Kleinman H, Martin GR, Meneguzzi G, Paulsson M and Sanes J.
Journal Matrix Biol. 14 (3), 209-211 (1994)
Title Distribution and isolation of four laminin variants; tissue restricted distribution of heterotrimers assembled from five different subunits .
Author Engvall E, Earwicker D, Haaparanta T, Ruoslahti E and Sanes JR.
Journal Cell Regul. 1 (10), 731-740 (1990)
Title A laminin-like adhesive protein concentrated in the synaptic cleft of the neuromuscular junction .
Author Hunter DD, Shah V, Merlie JP and Sanes JR.
Journal Nature 338 (6212), 229-234 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.