• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu08149 Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu08149C Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002300.6, 291575126
Length 1005 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 1, mRNA.
Product L-lactate dehydrogenase B chain
Comment

Summary: This gene encodes an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on the X chromosome and on chromosome. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Mar 2010].


Transcript Variant: This variant (1) represents the shorter transcript. Both variants 1 and 2 encode the same protein.

RefSeq NP_002291.1
CDS 112..1116
Misc Feature(1)49..51
Misc Feature(2)115..117
Misc Feature(3)115..117
Misc Feature(4)121..1107
Misc Feature(5)130..132
Misc Feature(6)169..1101
Misc Feature(7)order(172..174,655..657,664..666,670..672,721..723,
Misc Feature(8)order(199..207,268..270,274..276,283..285,397..411,
Misc Feature(9)order(211..213,226..228,292..297,304..306,310..315,
Misc Feature(10)241..243
Misc Feature(11)283..285
Misc Feature(12)order(412..414,430..432,526..528,619..621,691..693,
Misc Feature(13)466..468
Misc Feature(14)829..831
Misc Feature(15)829..831
Misc Feature(16)829..831
Misc Feature(17)1096..1098
Exon (1)1..105
Gene:LDHB
Gene Synonym:HEL-S-281; LDH-B; LDH-H; LDHBD; TRG-5
Exon (2)106..240
Gene:LDHB
Gene Synonym:HEL-S-281; LDH-B; LDH-H; LDHBD; TRG-5
Exon (3)241..358
Gene:LDHB
Gene Synonym:HEL-S-281; LDH-B; LDH-H; LDHBD; TRG-5
Exon (4)359..532
Gene:LDHB
Gene Synonym:HEL-S-281; LDH-B; LDH-H; LDHBD; TRG-5
Exon (5)533..706
Gene:LDHB
Gene Synonym:HEL-S-281; LDH-B; LDH-H; LDHBD; TRG-5
Exon (6)707..824
Gene:LDHB
Gene Synonym:HEL-S-281; LDH-B; LDH-H; LDHBD; TRG-5
Exon (7)825..948
Gene:LDHB
Gene Synonym:HEL-S-281; LDH-B; LDH-H; LDHBD; TRG-5
Exon (8)949..1317
Gene:LDHB
Gene Synonym:HEL-S-281; LDH-B; LDH-H; LDHBD; TRG-5
Translation MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG LTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(29..31)-dbSNP:
complement(29..31)-cgg, ggadbSNP:386761098
complement(29)-g, adbSNP:74069330
complement(31)-g, cdbSNP:74069329
complement(60)-c, adbSNP:370087403
complement(110)-dbSNP:
complement(110)-t, gdbSNP:372355833
130+a, gdbSNP:118203897
complement(133)-g, adbSNP:200724789
complement(150)-t, cdbSNP:143907515
165+a, cdbSNP:11547929
complement(187)-t, cdbSNP:374033725
complement(211)-t, cdbSNP:201820178
complement(234)-g, cdbSNP:370993243
complement(248)-dbSNP:
complement(248)-g, cdbSNP:184328547
complement(276)-c, adbSNP:75808403
complement(310)-g, adbSNP:180857589
complement(372)-dbSNP:
complement(372)-g, adbSNP:1650294
complement(373)-t, cdbSNP:145369309
complement(399)-c, adbSNP:201280606
404+g, tdbSNP:11547925
411+a, tdbSNP:11547931
complement(437)-t, cdbSNP:200872434
478+a, cdbSNP:11547927
479+c, tdbSNP:11547922
complement(486)-g, adbSNP:141707607
487+a, g, tdbSNP:11547923
496+a, cdbSNP:118203896
complement(504)-g, adbSNP:138677889
complement(543)-dbSNP:
complement(543)-g, adbSNP:200362342
complement(546)-t, cdbSNP:112045700
complement(565)-t, cdbSNP:201787369
complement(584)-t, cdbSNP:200163319
complement(585)-t, gdbSNP:374548634
complement(599)-, cdbSNP:35460727
complement(622)-g, adbSNP:370642139
626+a, gdbSNP:118203895
complement(631)-g, adbSNP:140905990
complement(634)-t, cdbSNP:7966339
complement(668)-c, adbSNP:200917173
complement(671)-t, cdbSNP:143676408
complement(696)-g, adbSNP:141629567
complement(706)-t, cdbSNP:113612324
complement(732)-dbSNP:
complement(732)-c, adbSNP:147896432
complement(738)-c, adbSNP:201960895
760+c, tdbSNP:11547926
complement(761)-g, adbSNP:201634450
complement(802)-t, cdbSNP:201548991
complement(810)-g, cdbSNP:375806839
complement(830)-dbSNP:
complement(830)-t, cdbSNP:369382991
complement(858)-g, cdbSNP:375117218
complement(860)-t, cdbSNP:144739734
complement(868)-t, cdbSNP:373042868
complement(878)-t, cdbSNP:145355418
complement(901)-t, cdbSNP:369578843
complement(927)-g, adbSNP:375297310
complement(931)-t, cdbSNP:200161747
complement(937)-t, cdbSNP:200158121
complement(954)-dbSNP:
complement(954)-t, cdbSNP:150060988
990+a, gdbSNP:4828
complement(1001)-t, cdbSNP:185741414
complement(1005)-t, gdbSNP:368159310
1084+c, tdbSNP:267607212
complement(1104)-t, cdbSNP:150503665
complement(1113)-c, adbSNP:375308907
1127+c, tdbSNP:3203471
complement(1162)-t, cdbSNP:370588752
complement(1166)-g, adbSNP:372286836
1207+c, tdbSNP:15141
Gene SymbolLDHB
Gene SynonymHEL-S-281; LDH-B; LDH-H; LDHBD; TRG-5
Chromosome12
Locus Map12p12.2-p12.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002300 Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_002300 Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_002300 Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 1, mRNA. In-stock $99.00 5-7
Title Lactate dehydrogenase B: a metabolic marker of response to neoadjuvant chemotherapy in breast cancer .
Author Dennison JB, Molina JR, Mitra S, Gonzalez-Angulo AM, Balko JM, Kuba MG, Sanders ME, Pinto JA, Gomez HL, Arteaga CL, Brown RE and Mills GB.
Journal Clin. Cancer Res. 19 (13), 3703-3713 (2013)
Title Serum lactic dehydrogenase strongly predicts survival in metastatic nasopharyngeal carcinoma treated with palliative chemotherapy .
Author Jin Y, Ye X, Shao L, Lin BC, He CX, Zhang BB and Zhang YP.
Journal Eur. J. Cancer 49 (7), 1619-1626 (2013)
Title Lactate dehydrogenase B is required for the growth of KRAS-dependent lung adenocarcinomas .
Author McCleland ML, Adler AS, Deming L, Cosino E, Lee L, Blackwood EM, Solon M, Tao J, Li L, Shames D, Jackson E, Forrest WF and Firestein R.
Journal Clin. Cancer Res. 19 (4), 773-784 (2013)
Title Estrogen-related receptor alpha modulates lactate dehydrogenase activity in thyroid tumors .
Author Mirebeau-Prunier D, Le Pennec S, Jacques C, Fontaine JF, Gueguen N, Boutet-Bouzamondo N, Donnart A, Malthiery Y and Savagner F.
Journal PLoS ONE 8 (3), E58683 (2013)
Title Lactate dehydrogenase-B is silenced by promoter methylation in a high frequency of human breast cancers .
Author Brown NJ, Higham SE, Perunovic B, Arafa M, Balasubramanian S and Rehman I.
Journal PLoS ONE 8 (2), E57697 (2013)
Title Molecular characterization of genetic mutations in human lactate dehydrogenase (LDH) B (H) variant .
Author Sudo K, Maekawa M, Tomonaga A, Tsukada T, Nakayama T, Kitamura M, Li SS, Kanno T and Toriumi J.
Journal Hum. Genet. 89 (2), 158-162 (1992)
Title Human centrosomal epitope is shared specifically with human lactate dehydrogenase-B isozyme .
Author Gosti F, Li SS, Maunoury R and Bornens M.
Journal FEBS Lett. 299 (3), 231-234 (1992)
Title A missense mutation found in human lactate dehydrogenase-B (H) variant gene .
Author Sudo K, Maekawa M, Ikawa S, Machida K, Kitamura M and Li SS.
Journal Biochem. Biophys. Res. Commun. 168 (2), 672-676 (1990)
Title Structure of the human lactate dehydrogenase B gene .
Author Takeno T and Li SS.
Journal Biochem. J. 257 (3), 921-924 (1989)
Title [Increase of the LDH-B activity in a boy with 12p trisomy by malsegregation of a maternal translocation t(12;14) (q12;p11)] .
Author Rethore,M.O., Kaplan,J.C., Junien,C., Cruveiller,J., Dutrillaux,B., Aurias,A., Carpentier,S., Lafourcade,J. and Lejeune.
Journal Ann. Genet. 18 (2), 81-87 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.