• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002300 Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_002300.6, 291575126
Length 1317 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 1, mRNA.
Product L-lactate dehydrogenase B chain
Comment

Summary: This gene encodes an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on the X chromosome and on chromosome. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Mar 2010].


Transcript Variant: This variant (1) represents the shorter transcript. Both variants 1 and 2 encode the same protein.

RefSeq NP_002291.1
CDS 112..1116
Misc Feature(1)49..51
Misc Feature(2)115..117
Misc Feature(3)115..117
Misc Feature(4)130..132
Misc Feature(5)169..1101
Misc Feature(6)order(172..174,655..657,664..666,670..672,721..723,
Misc Feature(7)187..1089
Misc Feature(8)order(199..207,268..270,274..276,283..285,397..411,
Misc Feature(9)order(211..213,226..228,292..297,304..306,310..315,
Misc Feature(10)241..243
Misc Feature(11)283..285
Misc Feature(12)order(412..414,430..432,526..528,619..621,691..693,
Misc Feature(13)466..468
Misc Feature(14)829..831
Misc Feature(15)829..831
Misc Feature(16)829..831
Misc Feature(17)1096..1098
Exon (1)1..105
Gene:LDHB
Gene Synonym:LDH-B; LDH-H; LDHBD; TRG-5
Exon (2)106..240
Gene:LDHB
Gene Synonym:LDH-B; LDH-H; LDHBD; TRG-5
Exon (3)241..358
Gene:LDHB
Gene Synonym:LDH-B; LDH-H; LDHBD; TRG-5
Exon (4)359..532
Gene:LDHB
Gene Synonym:LDH-B; LDH-H; LDHBD; TRG-5
Exon (5)533..706
Gene:LDHB
Gene Synonym:LDH-B; LDH-H; LDHBD; TRG-5
Exon (6)707..824
Gene:LDHB
Gene Synonym:LDH-B; LDH-H; LDHBD; TRG-5
Exon (7)825..948
Gene:LDHB
Gene Synonym:LDH-B; LDH-H; LDHBD; TRG-5
Exon (8)949..1317
Gene:LDHB
Gene Synonym:LDH-B; LDH-H; LDHBD; TRG-5
Translation MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG LTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(29)-dbSNP:
complement(29)-g, adbSNP:74069330
complement(31)-g, cdbSNP:74069329
complement(130)-g, adbSNP:118203897
complement(133)-g, adbSNP:200724789
complement(150)-t, cdbSNP:143907515
complement(165)-c, adbSNP:11547929
complement(211)-t, cdbSNP:201820178
complement(248)-dbSNP:
complement(248)-g, cdbSNP:184328547
complement(276)-c, adbSNP:75808403
complement(310)-g, adbSNP:180857589
complement(372)-dbSNP:
complement(372)-g, adbSNP:1650294
complement(373)-t, cdbSNP:145369309
complement(399)-c, adbSNP:201280606
complement(404)-t, gdbSNP:11547925
complement(411)-t, adbSNP:11547931
complement(437)-t, cdbSNP:200872434
complement(478)-c, adbSNP:11547927
complement(479)-t, cdbSNP:11547922
complement(486)-g, adbSNP:141707607
complement(487)-t, g, adbSNP:11547923
complement(496)-c, adbSNP:118203896
complement(504)-g, adbSNP:138677889
complement(543)-dbSNP:
complement(543)-g, adbSNP:200362342
complement(546)-t, cdbSNP:112045700
complement(565)-t, cdbSNP:201787369
complement(584)-t, cdbSNP:200163319
complement(599)-, cdbSNP:35460727
complement(626)-g, adbSNP:118203895
complement(631)-g, adbSNP:140905990
complement(634)-t, cdbSNP:7966339
complement(668)-c, adbSNP:200917173
complement(671)-t, cdbSNP:143676408
complement(696)-g, adbSNP:141629567
complement(706)-t, cdbSNP:113612324
complement(732)-dbSNP:
complement(732)-c, adbSNP:147896432
complement(738)-c, adbSNP:201960895
complement(760)-t, cdbSNP:11547926
complement(761)-g, adbSNP:201634450
complement(802)-t, cdbSNP:201548991
complement(860)-dbSNP:
complement(860)-t, cdbSNP:144739734
complement(869)-g, adbSNP:140879796
complement(878)-t, cdbSNP:145355418
complement(931)-t, cdbSNP:200161747
complement(937)-t, cdbSNP:200158121
complement(954)-dbSNP:
complement(954)-t, cdbSNP:150060988
complement(990)-g, adbSNP:4828
complement(1001)-t, cdbSNP:185741414
complement(1079)-t, cdbSNP:15140
1084+c, tdbSNP:267607212
complement(1104)-t, cdbSNP:150503665
complement(1127)-t, cdbSNP:3203471
complement(1207)-t, cdbSNP:15141
Gene SymbolLDHB
Gene SynonymLDH-B; LDH-H; LDHBD; TRG-5
Chromosome12
Locus Map12p12.2-p12.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001174097 Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 2, mRNA. In-stock $418.00 $369.00 10
NM_002300 Homo sapiens lactate dehydrogenase B (LDHB), transcript variant 1, mRNA. In-stock $418.00 $369.00 10
Title An integrated genomic screen identifies LDHB as an essential gene for triple-negative breast cancer .
Author McCleland,M.L., Adler,A.S., Shang,Y., Hunsaker,T., Truong,T., Peterson,D., Torres,E., Li,L., Haley,B., Stephan,J.P., Belvin,M., Hatzivassiliou,G., Blackwood,E.M., Corson,L., Evangelista,M., Zha,J. and Firestein,R.
Journal Cancer Res. 72 (22), 5812-5823 (2012)
Title Serum lactate dehydrogenase predicts for overall survival benefit in patients with metastatic renal cell carcinoma treated with inhibition of mammalian target of rapamycin .
Author Armstrong,A.J., George,D.J. and Halabi,S.
Journal J. Clin. Oncol. 30 (27), 3402-3407 (2012)
Title Identification of novel molecular targets regulated by tumor suppressive miR-375 induced by histone acetylation in esophageal squamous cell carcinoma .
Author Isozaki,Y., Hoshino,I., Nohata,N., Kinoshita,T., Akutsu,Y., Hanari,N., Mori,M., Yoneyama,Y., Akanuma,N., Takeshita,N., Maruyama,T., Seki,N., Nishino,N., Yoshida,M. and Matsubara,H.
Journal Int. J. Oncol. 41 (3), 985-994 (2012)
Title The role of LDH serum levels in predicting global outcome in HCC patients undergoing TACE: implications for clinical management .
Author Scartozzi,M., Faloppi,L., Bianconi,M., Giampieri,R., Maccaroni,E., Bittoni,A., Del Prete,M., Loretelli,C., Belvederesi,L., Svegliati Baroni,G. and Cascinu,S.
Journal PLoS ONE 7 (3), E32653 (2012)
Title Serum creatine kinase and lactate dehydrogenase activities in patients with thyroid disorders .
Author McGrowder,D.A., Fraser,Y.P., Gordon,L., Crawford,T.V. and Rawlins,J.M.
Journal Niger J Clin Pract 14 (4), 454-459 (2011)
Title Molecular characterization of genetic mutations in human lactate dehydrogenase (LDH) B (H) variant .
Author Sudo,K., Maekawa,M., Tomonaga,A., Tsukada,T., Nakayama,T., Kitamura,M., Li,S.S., Kanno,T. and Toriumi,J.
Journal Hum. Genet. 89 (2), 158-162 (1992)
Title Human centrosomal epitope is shared specifically with human lactate dehydrogenase-B isozyme .
Author Gosti,F., Li,S.S., Maunoury,R. and Bornens,M.
Journal FEBS Lett. 299 (3), 231-234 (1992)
Title A missense mutation found in human lactate dehydrogenase-B (H) variant gene .
Author Sudo,K., Maekawa,M., Ikawa,S., Machida,K., Kitamura,M. and Li,S.S.
Journal Biochem. Biophys. Res. Commun. 168 (2), 672-676 (1990)
Title Structure of the human lactate dehydrogenase B gene .
Author Takeno,T. and Li,S.S.
Journal Biochem. J. 257 (3), 921-924 (1989)
Title [Increase of the LDH-B activity in a boy with 12p trisomy by malsegregation of a maternal translocation t(12;14) (q12;p11)] .
Author Rethore,M.O., Kaplan,J.C., Junien,C., Cruveiller,J., Dutrillaux,B., Aurias,A., Carpentier,S., Lafourcade,J. and Lejeune.
Journal Ann. Genet. 18 (2), 81-87 (1975)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.