• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens low density lipoprotein receptor-related protein 5 (LRP5), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27945 Homo sapiens low density lipoprotein receptor-related protein 5 (LRP5), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand TBD TBD
OHu27945C Homo sapiens low density lipoprotein receptor-related protein 5 (LRP5), transcript variant 1, mRNA. Customized vector On-demand TBD TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002335.3, 631790827
Length 4848 bp
Structure linear
Update Date 11-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens low density lipoprotein receptor-related protein 5 (LRP5), transcript variant 1, mRNA.
Product low-density lipoprotein receptor-related protein 5 isoform 1 precursor
Comment

Summary: This gene encodes a transmembrane low-density lipoprotein receptor that binds and internalizes ligands in the process of receptor-mediated endocytosis. This protein also acts as a co-receptor with Frizzled protein family members for transducing signals by Wnt proteins and was originally cloned on the basis of its association with type 1 diabetes mellitus in humans. This protein plays a key role in skeletal homeostasis and many bone density related diseases are caused by mutations in this gene. Mutations in this gene also cause familial exudative vitreoretinopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_002326.2
CDS 107..4954
Misc Feature(1)71..73
Misc Feature(2)71..73
Misc Feature(3)200..970
Misc Feature(4)410..532
Misc Feature(5)593..715
Misc Feature(6)665..793
Misc Feature(7)848..976
Misc Feature(8)848..964
Misc Feature(9)1001..1114
Misc Feature(10)1127..1912
Misc Feature(11)1202..1324
Misc Feature(12)1328..1456
Misc Feature(13)1517..1639
Misc Feature(14)1589..1717
Misc Feature(15)1718..1819
Misc Feature(16)1919..2026
Misc Feature(17)2036..2815
Misc Feature(18)2111..2233
Misc Feature(19)2234..2362
Misc Feature(20)2363..2494
Misc Feature(21)2501..2620
Misc Feature(22)2618..2743
Misc Feature(23)2822..2929
Misc Feature(24)2939..3742
Misc Feature(25)3014..3133
Misc Feature(26)3284..3415
Misc Feature(27)3416..3544
Misc Feature(28)3755..3865
Misc Feature(29)3881..3991
Misc Feature(30)order(3896..3898,3926..3928,3959..3964)
Misc Feature(31)order(3938..3940,3947..3949,3959..3961,3977..3982)
Misc Feature(32)3968..3982
Misc Feature(33)3998..4102
Misc Feature(34)order(4013..4015,4037..4039,4070..4075)
Misc Feature(35)order(4049..4051,4058..4060,4070..4072,4088..4093)
Misc Feature(36)4079..4093
Misc Feature(37)4112..4216
Misc Feature(38)order(4127..4129,4151..4153,4184..4189)
Misc Feature(39)order(4163..4165,4172..4174,4184..4186,4202..4207)
Misc Feature(40)4193..4207
Misc Feature(41)4259..4327
Misc Feature(42)4604..4624
Misc Feature(43)4718..4741
Misc Feature(44)4826..4849
Misc Feature(45)4877..4894
Misc Feature(46)4919..4942
Exon (1)1..197
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (2)198..594
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (3)595..792
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (4)793..989
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (5)990..1121
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (6)1122..1518
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (7)1519..1690
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (8)1691..1907
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (9)1908..2197
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (10)2198..2424
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (11)2425..2609
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (12)2610..2933
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (13)2934..3133
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (14)3134..3342
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (15)3343..3533
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (16)3534..3743
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (17)3744..3869
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (18)3870..4106
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (19)4107..4217
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (20)4218..4454
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (21)4455..4594
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (22)4595..4692
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (23)4693..5159
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Translation MEAAPPGPPWPLLLLLLLLLALCGCPAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVS GLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGK KLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAG MDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHP FALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCE EDNGGCSHLCLLSPSEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTP DFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDG IAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGE NPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTL LEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVV GTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISL ETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYP EGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEW GGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVV IADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQ DGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKSAISRMI PDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQ NPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGY LYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCD LSGANRLTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVAHLTG IHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCS PDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGE ADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDS PAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAP GGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNP PPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKAS KYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolLRP5
Gene SynonymBMND1; EVR1; EVR4; HBM; LR3; LRP-5; LRP7; OPPG; OPS; OPTA1; VBCH2
Chromosome11
Locus Map11q13.4
Title Multivesicular GSK3 sequestration upon Wnt signaling is controlled by p120-catenin/cadherin interaction with LRP5/6 .
Author Vinyoles M, Del Valle-Perez B, Curto J, Vinas-Castells R, Alba-Castellon L, Garcia de Herreros A and Dunach M.
Journal Mol. Cell 53 (3), 444-457 (2014)
Title Polymorphism of LRP5, but not of TNFRSF11B, is associated with a decrease in bone mineral density in postmenopausal Maya-Mestizo women .
Author Canto-Cetina T, Polanco Reyes L, Gonzalez Herrera L, Rojano-Mejia D, Coral-Vazquez RM, Coronel A and Canto P.
Journal Am. J. Hum. Biol. 25 (6), 713-718 (2013)
Title Aberrant and alternative splicing in skeletal system disease .
Author Fan X and Tang L.
Journal Gene 528 (1), 21-26 (2013)
Title Low-density lipoprotein receptor-related protein 5 gene polymorphisms and genetic susceptibility to abdominal aortic aneurysm .
Author Galora S, Saracini C, Palombella AM, Pratesi G, Pulli R, Pratesi C, Abbate R and Giusti B.
Journal J. Vasc. Surg. 58 (4), 1062-1068 (2013)
Title Genetic variants of FZD4 and LRP5 genes in patients with advanced retinopathy of prematurity .
Author Kondo H, Kusaka S, Yoshinaga A, Uchio E, Tawara A and Tahira T.
Journal Mol. Vis. 19, 476-485 (2013)
Title Cloning of a novel member of the low-density lipoprotein receptor family .
Author Hey PJ, Twells RC, Phillips MS, Yusuke Nakagawa, Brown SD, Kawaguchi Y, Cox R, Guochun Xie, Dugan V, Hammond H, Metzker ML, Todd JA and Hess JF.
Journal Gene 216 (1), 103-111 (1998)
Title Linkage of a gene causing high bone mass to human chromosome 11 (11q12-13) .
Author Johnson ML, Gong G, Kimberling W, Recker SM, Kimmel DB and Recker RB.
Journal Am. J. Hum. Genet. 60 (6), 1326-1332 (1997)
Title Osteoporosis-pseudoglioma syndrome, a disorder affecting skeletal strength and vision, is assigned to chromosome region 11q12-13 .
Author Gong Y, Vikkula M, Boon L, Liu J, Beighton P, Ramesar R, Peltonen L, Somer H, Hirose T, Dallapiccola B, De Paepe A, Swoboda W, Zabel B, Superti-Furga A, Steinmann B, Brunner HG, Jans A, Boles RG, Adkins W, van den Boogaard MJ, Olsen BR and Warman ML.
Journal Am. J. Hum. Genet. 59 (1), 146-151 (1996)
Title Identification of the low density lipoprotein receptor-related protein (LRP) as an endocytic receptor for thrombospondin-1 .
Author Godyna S, Liau G, Popa I, Stefansson S and Argraves WS.
Journal J. Cell Biol. 129 (5), 1403-1410 (1995)
Title Familial Exudative Vitreoretinopathy, Autosomal Dominant .
Author Toomes,C. and Downey,L.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.