• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens low density lipoprotein receptor-related protein 5 (LRP5), mRNA.


RefSeq Accession Definition Services Price Order
NM_002335 Homo sapiens low density lipoprotein receptor-related protein 5 (LRP5), mRNA. ORF Sequence $1696.80
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002335.2, 119709831
Length 5161 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens low density lipoprotein receptor-related protein 5 (LRP5), mRNA.
Product low-density lipoprotein receptor-related protein 5 precursor
Comment

Summary: This gene encodes a transmembrane low-density lipoprotein receptor that binds and internalizes ligands in the process of receptor-mediated endocytosis. This protein also acts as a co-receptor with Frizzled protein family members for transducing signals by Wnt proteins and was originally cloned on the basis of its association with type 1 diabetes mellitus in humans. This protein plays a key role in skeletal homeostasis and many bone density related diseases are caused by mutations in this gene. Mutations in this gene also cause familial exudative vitreoretinopathy. [provided by RefSeq, Nov 2009].

RefSeq NP_002326.2
CDS 76..4923
Misc Feature(1)40..42
Misc Feature(2)40..42
Misc Feature(3)169..939
Misc Feature(4)379..501
Misc Feature(5)562..684
Misc Feature(6)634..762
Misc Feature(7)763..867
Misc Feature(8)817..945
Misc Feature(9)1096..1881
Misc Feature(10)1171..1293
Misc Feature(11)1297..1425
Misc Feature(12)1426..1557
Misc Feature(13)1558..1686
Misc Feature(14)1687..1788
Misc Feature(15)2005..2784
Misc Feature(16)2080..2202
Misc Feature(17)2203..2331
Misc Feature(18)2332..2463
Misc Feature(19)2470..2589
Misc Feature(20)2587..2712
Misc Feature(21)2908..3711
Misc Feature(22)2983..3102
Misc Feature(23)3253..3384
Misc Feature(24)3385..3513
Misc Feature(25)3850..3960
Misc Feature(26)order(3865..3867,3895..3897,3928..3933)
Misc Feature(27)order(3907..3909,3916..3918,3928..3930,3946..3951)
Misc Feature(28)3937..3951
Misc Feature(29)3967..4071
Misc Feature(30)order(3982..3984,4006..4008,4039..4044)
Misc Feature(31)order(4018..4020,4027..4029,4039..4041,4057..4062)
Misc Feature(32)4048..4062
Misc Feature(33)4081..4185
Misc Feature(34)order(4096..4098,4120..4122,4153..4158)
Misc Feature(35)order(4132..4134,4141..4143,4153..4155,4171..4176)
Misc Feature(36)4162..4176
Misc Feature(37)4228..4296
Misc Feature(38)4573..4593
Misc Feature(39)4687..4710
Misc Feature(40)4795..4818
Misc Feature(41)4846..4863
Misc Feature(42)4888..4911
Exon (1)1..166
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (2)167..563
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (3)564..761
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (4)762..958
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (5)959..1090
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (6)1091..1487
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (7)1488..1659
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (8)1660..1876
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (9)1877..2166
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (10)2167..2393
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (11)2394..2578
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (12)2579..2902
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (13)2903..3102
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (14)3103..3311
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (15)3312..3502
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (16)3503..3712
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (17)3713..3838
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (18)3839..4075
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (19)4076..4186
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (20)4187..4423
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (21)4424..4563
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (22)4564..4661
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Exon (23)4662..5128
Gene:LRP5
Gene Synonym:BMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Translation MEAAPPGPPWPLLLLLLLLLALCGCPAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVS GLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGK KLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAG MDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHP FALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCE EDNGGCSHLCLLSPSEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTP DFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDG IAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGE NPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTL LEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVV GTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISL ETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYP EGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEW GGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVV IADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQ DGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKSAISRMI PDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQ NPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGY LYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCD LSGANRLTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVAHLTG IHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCS PDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGE ADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDS PAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAP GGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNP PPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKAS KYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
104+a, gdbSNP:121908660
171+dbSNP:
171+a, gdbSNP:202039395
175+c, tdbSNP:118154213
204+a, tdbSNP:144719110
239+c, tdbSNP:148462220
287+a, gdbSNP:142607308
325+a, gdbSNP:201119420
338+a, gdbSNP:78219242
341+a, gdbSNP:41494349
365+c, tdbSNP:143433231
366+c, tdbSNP:146667935
379+a, gdbSNP:140216273
399+c, gdbSNP:11574419
420+c, tdbSNP:144053326
439+c, gdbSNP:144939255
459+a, gdbSNP:138651503
499+c, tdbSNP:201093134
501+c, gdbSNP:201193537
508+c, tdbSNP:80358305
534+a, gdbSNP:78844574
561+c, tdbSNP:191882942
586+dbSNP:
586+c, gdbSNP:121908669
587+g, tdbSNP:121908668
593+c, tdbSNP:80358306
594+a, gdbSNP:148128016
607+c, tdbSNP:200728516
608+g, tdbSNP:183377804
626+a, gdbSNP:142649952
631+c, tdbSNP:200484935
632+a, gdbSNP:146895334
644+c, tdbSNP:199787141
651+a, gdbSNP:139063572
675+a, gdbSNP:142973246
714+c, tdbSNP:150859573
715+a, gdbSNP:121908671
716+c, tdbSNP:121908672
745+a, cdbSNP:201681766
750+c, tdbSNP:138207107
755+c, tdbSNP:200384949
789+dbSNP:
789+a, gdbSNP:149522146
799+a, gdbSNP:121908670
822+a, tdbSNP:144040425
833+c, tdbSNP:121908673
878..887+, gggggaagagdbSNP:80358307
1082+dbSNP:
1082+a, gdbSNP:139896674
1096+dbSNP:
1096+a, gdbSNP:184945579
1107+c, gdbSNP:143499301
1120+c, tdbSNP:200740071
1152+a, gdbSNP:200179967
1155+a, gdbSNP:146264359
1161+c, tdbSNP:1043461
1209+c, tdbSNP:139130382
1215+c, tdbSNP:142506263
1251+c, tdbSNP:202236798
1259+a, gdbSNP:201539068
1274+c, tdbSNP:201320326
1284+c, tdbSNP:142055640
1296+a, gdbSNP:150970251
1301+c, tdbSNP:199686378
1302+a, gdbSNP:140779623
1323+c, tdbSNP:149682423
1330+a, gdbSNP:200789047
1357+c, tdbSNP:121908661
1374+c, tdbSNP:145362529
1391+a, gdbSNP:201547952
1393+a, gdbSNP:201779301
1403+c, tdbSNP:200416179
1404+a, gdbSNP:142511038
1405+c, tdbSNP:80358308
1432+c, tdbSNP:12364012
1440+a, gdbSNP:146912729
1462..1463+, cdbSNP:34216038
1470+a, gdbSNP:200075657
1476+c, tdbSNP:113518978
1479+c, tdbSNP:141584467
1528+dbSNP:
1528+g, tdbSNP:121908666
1556+a, gdbSNP:121908664
1559+a, gdbSNP:200409162
1571+a, gdbSNP:150771999
1577+c, tdbSNP:145897519
1593+c, tdbSNP:148073961
1639+a, gdbSNP:80358309
1679+dbSNP:
1679+c, tdbSNP:80358310
1680+a, gdbSNP:141896162
1683+a, gdbSNP:150209973
1688+a, gdbSNP:138692892
1717+a, gdbSNP:201576246
1722+a, gdbSNP:545382
1723+a, gdbSNP:80358311
1731+a, gdbSNP:146285115
1737+a, gdbSNP:184457951
1758+c, tdbSNP:139408531
1779+c, tdbSNP:200627198
1782+a, gdbSNP:199707305
1783+c, tdbSNP:121908665
1784+a, gdbSNP:80358312
1813+a, gdbSNP:149524398
1873+a, gdbSNP:143878170
1875+c, tdbSNP:200800275
1887+dbSNP:
1887+a, gdbSNP:200163787
1893+a, gdbSNP:148603249
1903+a, gdbSNP:80358313
1908+a, gdbSNP:142126662
1925+g, tdbSNP:80358314
1939+c, gdbSNP:147792724
1962+c, tdbSNP:140958524
1998+c, tdbSNP:17848264
2007+c, tdbSNP:2277268
2043+c, tdbSNP:144847027
2055+c, tdbSNP:140604679
2070+c, tdbSNP:150471658
2071+a, gdbSNP:180941579
2074+a, c, gdbSNP:4988321
2078+c, tdbSNP:149130784
2084+c, tdbSNP:201207267
2085+a, gdbSNP:143304197
2121+c, tdbSNP:61740517
2155+a, gdbSNP:141796804
2177+dbSNP:
2177+a, gdbSNP:145008551
2190+c, tdbSNP:145456776
2199+a, gdbSNP:140977837
2208+c, tdbSNP:33958013
2214+a, gdbSNP:34369535
2217+a, gdbSNP:201973717
2226..2227+, tdbSNP:121908662
2242+a, gdbSNP:139479176
2250+c, tdbSNP:200570645
2257+a, tdbSNP:149241739
2268+c, tdbSNP:147388442
2277+a, gdbSNP:121908667
2283+c, tdbSNP:35298380
2295+c, tdbSNP:2306862
2301+c, tdbSNP:147932332
2309+c, tdbSNP:148550774
2311+c, tdbSNP:201916993
2319+c, tdbSNP:142986090
2329+c, gdbSNP:121908674
2341+a, gdbSNP:138777930
2358+c, gdbSNP:151110465
2370+a, gdbSNP:140955013
2377+c, gdbSNP:80358315
2399+dbSNP:
2399+c, tdbSNP:144983823
2409+c, gdbSNP:146773034
2433+c, g, tdbSNP:140616444
2467+a, gdbSNP:80358316
2483+c, tdbSNP:145674002
2496+c, tdbSNP:138051657
2518+a, gdbSNP:200483542
2520+c, tdbSNP:149080536
2604+dbSNP:
2604+c, tdbSNP:143204891
2619+a, gdbSNP:148271293
2632+c, tdbSNP:121908663
2649+c, tdbSNP:140411171
2670+g, tdbSNP:200079431
2704+c, tdbSNP:200501120
2712+c, tdbSNP:141174027
2721+c, gdbSNP:147352603
2794+a, gdbSNP:137861541
2799+c, gdbSNP:143539498
2838+c, tdbSNP:147158768
2841+c, tdbSNP:139372523
2880..2881+, cdbSNP:150625922
2904+dbSNP:
2904+a, gdbSNP:201018263
2912+c, tdbSNP:201639368
2957+c, tdbSNP:189095829
2958+a, gdbSNP:150031686
2961+c, tdbSNP:144415767
3021+c, tdbSNP:147716006
3034+a, c, gdbSNP:61370283
3039+c, tdbSNP:200117377
3091+a, gdbSNP:147758521
3093+c, tdbSNP:146792434
3103+dbSNP:
3103+c, tdbSNP:201793593
3152+c, tdbSNP:201745746
3154+c, tdbSNP:140482319
3182+a, gdbSNP:61889560
3222+c, tdbSNP:200247220
3231+a, gdbSNP:199675099
3271+c, tdbSNP:201285828
3291+c, tdbSNP:200786182
3320+dbSNP:
3320+a, gdbSNP:113804402
3331+a, gdbSNP:145774832
3354+c, gdbSNP:140852936
3358+c, tdbSNP:201957991
3360+c, tdbSNP:80038357
3361+a, gdbSNP:189758820
3366+c, tdbSNP:199822785
3372+c, tdbSNP:17149104
3384+c, tdbSNP:141446007
3432+a, gdbSNP:556442
3436+a, gdbSNP:80358317
3443+c, tdbSNP:137928647
3467+c, tdbSNP:199960554
3478+c, tdbSNP:143396225
3521+dbSNP:
3521+a, tdbSNP:200389686
3528+c, tdbSNP:147175387
3577+c, tdbSNP:80358318
3603+a, gdbSNP:148217741
3613+a, gdbSNP:186535471
3637+c, gdbSNP:141178995
3639+a, gdbSNP:117289001
3656+a, gdbSNP:201017887
3661+a, gdbSNP:199887400
3675+c, tdbSNP:202207765
3685+c, gdbSNP:11607268
3730+dbSNP:
3730+c, tdbSNP:139847357
3731+a, gdbSNP:143924910
3772+a, gdbSNP:146388120
3798+a, gdbSNP:139554243
3801+c, tdbSNP:201107260
3868+dbSNP:
3868+c, gdbSNP:201530801
3878+c, gdbSNP:144199169
3879+, adbSNP:80358319
3911+a, gdbSNP:145293239
3918+c, tdbSNP:200373872
3927+c, tdbSNP:144115017
3976+a, gdbSNP:149166384
3993+a, gdbSNP:11574425
4018+c, tdbSNP:151200211
4026+c, tdbSNP:141306017
4029+c, tdbSNP:201352823
4064+c, tdbSNP:3736228
4065+a, gdbSNP:147637431
4091+dbSNP:
4091+a, gdbSNP:142001526
4100+g, tdbSNP:150088620
4104+c, tdbSNP:138359428
4118+a, gdbSNP:149275252
4152+c, tdbSNP:143482432
4156+g, tdbSNP:80358320
4164+c, tdbSNP:3736229
4165+a, gdbSNP:146404570
4170+c, tdbSNP:199576767
4174+a, gdbSNP:28939709
4194..4195+dbSNP:
4194..4195+, cdbSNP:80358321
4212+c, tdbSNP:139755343
4237+a, gdbSNP:143015732
4269+c, tdbSNP:150618161
4270+a, gdbSNP:113315676
4276+a, gdbSNP:200552541
4284+c, gdbSNP:147671915
4303+a, gdbSNP:200121061
4323+a, gdbSNP:17848257
4331+a, gdbSNP:145750689
4332+c, tdbSNP:201374967
4344+a, gdbSNP:139701701
4347+c, tdbSNP:145226802
4353+c, tdbSNP:142328132
4360+a, gdbSNP:201210158
4368+a, gdbSNP:142283161
4372+g, tdbSNP:199871539
4412+g, tdbSNP:143166423
4428+dbSNP:
4428+c, tdbSNP:151148660
4455+c, tdbSNP:11574420
4466+c, tdbSNP:113007633
4475+a, gdbSNP:150332207
4480+a, gdbSNP:188909481
4506+c, tdbSNP:11574426
4521+a, gdbSNP:142191419
4533+a, g, tdbSNP:75571306
4586+dbSNP:
4586+c, tdbSNP:201475647
4596..4597+, cdbSNP:34310730
4625+a, gdbSNP:201030241
4640+c, tdbSNP:200624778
4649+c, tdbSNP:1127291
4655+c, tdbSNP:80291963
4675+dbSNP:
4675+c, gdbSNP:149645175
4684+a, gdbSNP:144376510
4691+c, tdbSNP:148725079
4694+c, tdbSNP:141407040
4697+c, gdbSNP:150862227
4698+a, gdbSNP:139974816
4710+c, tdbSNP:145406397
4718+g, tdbSNP:147618989
4734+c, g, tdbSNP:112415702
4741+c, tdbSNP:140474222
4764+c, tdbSNP:149752460
4779+a, gdbSNP:145608758
4803+a, cdbSNP:201603736
4863+c, g, tdbSNP:113442867
4866+c, gdbSNP:142508112
5027+a, gdbSNP:116937625
Gene SymbolLRP5
Gene SynonymBMND1; EVR1; EVR4; HBM; LR3; LRP7; OPPG; OPS; OPTA1; VBCH2
Chromosome11
Locus Map11q13.4
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002335 Homo sapiens low density lipoprotein receptor-related protein 5 (LRP5), mRNA. Full Length $2322.45
ORF Sequence $1696.80
Title Characterization of the interaction of sclerostin with the low density lipoprotein receptor-related protein (LRP) family of Wnt co-receptors .
Author Holdsworth,G., Slocombe,P., Doyle,C., Sweeney,B., Veverka,V., Le Riche,K., Franklin,R.J., Compson,J., Brookings,D., Turner,J., Kennedy,J., Garlish,R., Shi,J., Newnham,L., McMillan,D., Muzylak,M., Carr,M.D., Henry,A.J., Ceska,T. and Robinson,M.K.
Journal J. Biol. Chem. 287 (32), 26464-26477 (2012)
Title Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture .
Author Estrada,K., Styrkarsdottir,U., Evangelou,E., Hsu,Y.H., Duncan,E.L., Ntzani,E.E., Oei,L., Albagha,O.M., Amin,N., Kemp,J.P., Koller,D.L., Li,G., Liu,C.T., Minster,R.L., Moayyeri,A., Vandenput,L., Willner,D., Xiao,S.M., Yerges-Armstrong,L.M., Zheng,H.F., Alonso,N., Eriksson,J., Kammerer,C.M., Kaptoge,S.K., Leo,P.J., Thorleifsson,G., Wilson,S.G., Wilson,J.F., Aalto,V., Alen,M., Aragaki,A.K., Aspelund,T., Center,J.R., Dailiana,Z., Duggan,D.J., Garcia,M., Garcia-Giralt,N., Giroux,S., Hallmans,G., Hocking,L.J., Husted,L.B., Jameson,K.A., Khusainova,R., Kim,G.S., Kooperberg,C., Koromila,T., Kruk,M., Laaksonen,M., Lacroix,A.Z., Lee,S.H., Leung,P.C., Lewis,J.R., Masi,L., Mencej-Bedrac,S., Nguyen,T.V., Nogues,X., Patel,M.S., Prezelj,J., Rose,L.M., Scollen,S., Siggeirsdottir,K., Smith,A.V., Svensson,O., Trompet,S., Trummer,O., van Schoor,N.M., Woo,J., Zhu,K., Balcells,S., Brandi,M.L., Buckley,B.M., Cheng,S., Christiansen,C., Cooper,C., Dedoussis,G., Ford,I., Frost,M., Goltzman,D., Gonzalez-Macias,J., Kahonen,M., Karlsson,M., Khusnutdinova,E., Koh,J.M., Kollia,P., Langdahl,B.L., Leslie,W.D., Lips,P., Ljunggren,O., Lorenc,R.S., Marc,J., Mellstrom,D., Obermayer-Pietsch,B., Olmos,J.M., Pettersson-Kymmer,U., Reid,D.M., Riancho,J.A., Ridker,P.M., Rousseau,F., Slagboom,P.E., Tang,N.L., Urreizti,R., Van Hul,W., Viikari,J., Zarrabeitia,M.T., Aulchenko,Y.S., Castano-Betancourt,M., Grundberg,E., Herrera,L., Ingvarsson,T., Johannsdottir,H., Kwan,T., Li,R., Luben,R., Medina-Gomez,C., Palsson,S.T., Reppe,S., Rotter,J.I., Sigurdsson,G., van Meurs,J.B., Verlaan,D., Williams,F.M., Wood,A.R., Zhou,Y., Gautvik,K.M., Pastinen,T., Raychaudhuri,S., Cauley,J.A., Chasman,D.I., Clark,G.R., Cummings,S.R., Danoy,P., Dennison,E.M., Eastell,R., Eisman,J.A., Gudnason,V., Hofman,A., Jackson,R.D., Jones,G., Jukema,J.W., Khaw,K.T., Lehtimaki,T., Liu,Y., Lorentzon,M., McCloskey,E., Mitchell,B.D., Nandakumar,K., Nicholson,G.C., Oostra,B.A., Peacock,M., Pols,H.A., Prince,R.L., Raitakari,O., Reid,I.R., Robbins,J., Sambrook,P.N., Sham,P.C., Shuldiner,A.R., Tylavsky,F.A., van Duijn,C.M., Wareham,N.J., Cupples,L.A., Econs,M.J., Evans,D.M., Harris,T.B., Kung,A.W., Psaty,B.M., Reeve,J., Spector,T.D., Streeten,E.A., Zillikens,M.C., Thorsteinsdottir,U., Ohlsson,C., Karasik,D., Richards,J.B., Brown,M.A., Stefansson,K., Uitterlinden,A.G., Ralston,S.H., Ioannidis,J.P., Kiel,D.P. and Rivadeneira,F.
Journal Nat. Genet. 44 (5), 491-501 (2012)
Title Identification of FZD4 and LRP5 mutations in 11 of 49 families with familial exudative vitreoretinopathy .
Author Yang,H., Li,S., Xiao,X., Wang,P., Guo,X. and Zhang,Q.
Journal Mol. Vis. 18, 2438-2446 (2012)
Title LRP5 regulates development of lung microvessels and alveoli through the angiopoietin-Tie2 pathway .
Author Mammoto,T., Chen,J., Jiang,E., Jiang,A., Smith,L.E., Ingber,D.E. and Mammoto,A.
Journal PLoS ONE 7 (7), E41596 (2012)
Title The structural basis of DKK-mediated inhibition of Wnt/LRP signaling .
Author Bao,J., Zheng,J.J. and Wu,D.
Journal Sci Signal 5 (224), PE22 (2012)
Title Molecular cloning and characterization of LR3, a novel LDL receptor family protein with mitogenic activity .
Author Dong,Y., Lathrop,W., Weaver,D., Qiu,Q., Cini,J., Bertolini,D. and Chen,D.
Journal Biochem. Biophys. Res. Commun. 251 (3), 784-790 (1998)
Title Cloning of a novel member of the low-density lipoprotein receptor family .
Author Hey,P.J., Twells,R.C., Phillips,M.S., Yusuke,Nakagawa., Brown,S.D., Kawaguchi,Y., Cox,R., Guochun,Xie., Dugan,V., Hammond,H., Metzker,M.L., Todd,J.A. and Hess,J.F.
Journal Gene 216 (1), 103-111 (1998)
Title Linkage of a gene causing high bone mass to human chromosome 11 (11q12-13) .
Author Johnson,M.L., Gong,G., Kimberling,W., Recker,S.M., Kimmel,D.B. and Recker,R.B.
Journal Am. J. Hum. Genet. 60 (6), 1326-1332 (1997)
Title Osteoporosis-pseudoglioma syndrome, a disorder affecting skeletal strength and vision, is assigned to chromosome region 11q12-13 .
Author Gong,Y., Vikkula,M., Boon,L., Liu,J., Beighton,P., Ramesar,R., Peltonen,L., Somer,H., Hirose,T., Dallapiccola,B., De Paepe,A., Swoboda,W., Zabel,B., Superti-Furga,A., Steinmann,B., Brunner,H.G., Jans,A., Boles,R.G., Adkins,W., van den Boogaard,M.J., Olsen,B.R. and Warman,M.L.
Journal Am. J. Hum. Genet. 59 (1), 146-151 (1996)
Title Identification of the low density lipoprotein receptor-related protein (LRP) as an endocytic receptor for thrombospondin-1 .
Author Godyna,S., Liau,G., Popa,I., Stefansson,S. and Argraves,W.S.
Journal J. Cell Biol. 129 (5), 1403-1410 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878