• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002337 Homo sapiens low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_002337.3, 336595168
Length 10536 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), mRNA.
Product alpha-2-macroglobulin receptor-associated protein precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DB035408.1, BC112067.1, BX647984.1, AK222504.1 and AL590235.23. On Jun 22, 2011 this sequence version replaced gi:194440683.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002328.1
CDS 86..1159
Misc Feature(1)50..52
Misc Feature(2)161..487
Misc Feature(3)374..376
Misc Feature(4)515..1156
Misc Feature(5)794..1144
Misc Feature(6)1145..1156
Exon (1)1..289
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; HBP44; MRAP; RAP
Exon (2)290..434
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; HBP44; MRAP; RAP
Exon (3)435..556
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; HBP44; MRAP; RAP
Exon (4)557..677
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; HBP44; MRAP; RAP
Exon (5)678..836
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; HBP44; MRAP; RAP
Exon (6)837..919
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; HBP44; MRAP; RAP
Exon (7)920..1096
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; HBP44; MRAP; RAP
Exon (8)1097..10536
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; HBP44; MRAP; RAP
Translation MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLN QLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILA KYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHK EKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRR VSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEI AHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(33..34)-dbSNP:
complement(33..34)-, gdbSNP:35394575
complement(63..64)-, cgdbSNP:3082915
complement(65)-g, adbSNP:141001956
complement(68)-g, cdbSNP:1800483
complement(104)-t, cdbSNP:17848316
complement(106)-t, cdbSNP:201770716
complement(118)-g, adbSNP:200330132
complement(166)-g, adbSNP:139828333
complement(173)-t, adbSNP:201806719
complement(195)-g, cdbSNP:148017639
complement(275)-g, cdbSNP:11940827
complement(287)-g, adbSNP:142940249
complement(292)-dbSNP:
complement(292)-t, cdbSNP:200867938
complement(304)-g, adbSNP:148553602
complement(306)-t, adbSNP:55856346
complement(353)-t, cdbSNP:146399188
complement(359)-t, c, adbSNP:142211110
complement(383)-t, g, adbSNP:11549511
complement(397)-g, adbSNP:139103216
complement(412)-t, cdbSNP:142669297
complement(414)-g, cdbSNP:201485938
complement(423)-g, adbSNP:11549516
complement(426)-g, adbSNP:2228158
complement(432)-g, adbSNP:34897511
complement(460)-dbSNP:
complement(460)-t, gdbSNP:150108954
complement(473)-t, cdbSNP:141746328
complement(504)-t, cdbSNP:190769048
complement(518)-t, cdbSNP:138080464
complement(520)-t, cdbSNP:147013302
complement(532)-t, cdbSNP:11549513
complement(550)-c, adbSNP:202126851
complement(551)-g, adbSNP:141393177
complement(581)-dbSNP:
complement(581)-t, cdbSNP:143848774
complement(583)-g, adbSNP:143257814
complement(637)-t, g, adbSNP:149133766
complement(645)-t, cdbSNP:145265768
complement(674)-t, cdbSNP:150001548
complement(680)-dbSNP:
complement(680)-g, adbSNP:35108689
complement(700)-g, adbSNP:199600966
complement(704)-t, adbSNP:146834891
complement(716)-t, g, cdbSNP:111244551
complement(723)-t, gdbSNP:140204942
complement(733)-g, adbSNP:138236468
complement(745)-t, cdbSNP:146148546
complement(750)-g, adbSNP:142076491
complement(771)-t, cdbSNP:148604784
complement(801)-t, cdbSNP:202048919
complement(814)-g, adbSNP:200151667
complement(835)-t, cdbSNP:13325
complement(883)-dbSNP:
complement(883)-g, cdbSNP:149473926
complement(917)-g, adbSNP:138120743
complement(918)-t, cdbSNP:192009446
complement(987)-dbSNP:
complement(987)-g, adbSNP:201384451
complement(988)-c, adbSNP:200532799
complement(1015)-t, cdbSNP:11549512
complement(1016)-g, adbSNP:1800493
complement(1024)-t, cdbSNP:35919694
complement(1033)-c, adbSNP:150160443
complement(1036)-t, cdbSNP:201496652
complement(1046)-g, adbSNP:200424526
complement(1047)-t, cdbSNP:140947105
complement(1058)-t, cdbSNP:148077268
complement(1064)-g, cdbSNP:200159569
complement(1074)-t, cdbSNP:143714310
complement(1095)-g, c, adbSNP:140565543
complement(1143)-dbSNP:
complement(1143)-t, cdbSNP:146814560
complement(1145)-g, cdbSNP:143841560
complement(1150)-g, adbSNP:141943482
complement(1151)-t, cdbSNP:141338615
complement(1164)-t, cdbSNP:148120809
complement(1165)-t, cdbSNP:6789
complement(1166)-t, cdbSNP:1801136
complement(1171)-g, adbSNP:1800495
complement(1180)-g, adbSNP:188271252
complement(1192)-t, cdbSNP:76983628
complement(1198)-g, adbSNP:200127365
complement(1246)-g, adbSNP:183983595
complement(1247)-t, cdbSNP:55683554
complement(1258)-t, adbSNP:113953397
complement(1321)-t, cdbSNP:1049574
complement(1356)-t, gdbSNP:1802967
complement(1435)-g, adbSNP:113801833
complement(1446)-t, gdbSNP:17848281
complement(1457)-t, cdbSNP:1049608
complement(1492)-t, adbSNP:77768479
complement(1516)-t, cdbSNP:139057451
complement(1544)-t, adbSNP:9995685
complement(1623)-t, gdbSNP:1794438
complement(1631)-t, cdbSNP:2077130
complement(1633)-g, adbSNP:191853111
complement(1700)-g, adbSNP:10024301
complement(1727)-g, adbSNP:116622990
complement(1774)-c, adbSNP:730748
complement(1811)-t, cdbSNP:62272702
complement(1812)-t, gdbSNP:188505547
complement(1917)-g, adbSNP:185183975
complement(1924)-t, cdbSNP:112750320
complement(1959)-t, cdbSNP:111558413
complement(1973)-t, cdbSNP:193226384
complement(1990)-g, adbSNP:3021475
complement(2019)-t, cdbSNP:1741554
complement(2026)-g, adbSNP:2093098
complement(2053)-g, adbSNP:113572632
complement(2072)-g, adbSNP:7442071
complement(2079)-t, cdbSNP:7436998
complement(2080)-g, adbSNP:1730761
complement(2101..2153)-dbSNP:71180192
complement(2106)-g, adbSNP:1794432
complement(2125)-g, adbSNP:13126792
complement(2132)-t, cdbSNP:112453164
complement(2133)-t, cdbSNP:13112088
complement(2149)-g, adbSNP:731819
complement(2159)-g, adbSNP:7442035
complement(2184)-g, adbSNP:13126754
complement(2185)-t, cdbSNP:111382803
complement(2186)-t, cdbSNP:13112054
complement(2202)-g, adbSNP:28699606
complement(2212)-g, adbSNP:111983747
complement(2217)-t, cdbSNP:112673739
complement(2237)-g, adbSNP:3897706
complement(2238)-t, cdbSNP:112366599
complement(2239)-t, cdbSNP:2014440
complement(2265)-g, adbSNP:113444648
complement(2290)-g, adbSNP:36101076
complement(2317)-t, cdbSNP:13146489
complement(2361)-g, adbSNP:2014431
complement(2365)-t, cdbSNP:2014430
complement(2380)-t, cdbSNP:183521495
complement(2386)-g, cdbSNP:189755673
complement(2405..2406)-, gggaadbSNP:78712138
complement(2410..2411)-, gggaadbSNP:144219259
complement(2415)-g, adbSNP:186967986
complement(2419)-t, cdbSNP:140821121
complement(2437)-t, gdbSNP:150975210
complement(2470)-g, adbSNP:28444167
complement(2487)-c, adbSNP:182634517
complement(2605..2606)-, gdbSNP:35931653
complement(2606)-g, adbSNP:113960400
complement(2642)-c, adbSNP:190269929
complement(2655)-g, cdbSNP:1741555
complement(2735)-t, cdbSNP:1741556
complement(2756)-t, cdbSNP:144053967
complement(2822)-g, cdbSNP:76598271
complement(3010)-g, adbSNP:146668093
complement(3170)-t, cdbSNP:1794424
complement(3216)-g, adbSNP:143154769
complement(3248)-t, cdbSNP:186773036
complement(3297)-t, cdbSNP:1794423
complement(3331)-t, gdbSNP:6848039
complement(3342)-g, adbSNP:181800416
complement(3371)-g, cdbSNP:6818522
complement(3381)-g, cdbSNP:192029686
complement(3390..3391)-, agatdbSNP:139078926
complement(3432)-g, adbSNP:73197125
complement(3467)-g, adbSNP:187115059
complement(3468)-t, cdbSNP:148809456
complement(3491)-t, cdbSNP:75577696
complement(3524)-t, cdbSNP:10014674
complement(3564)-t, adbSNP:182039375
complement(3587)-t, cdbSNP:144377775
complement(3712)-g, adbSNP:188126355
complement(3723)-t, cdbSNP:10014466
complement(3781)-g, adbSNP:149622962
complement(3876)-t, cdbSNP:35350183
complement(3917)-g, adbSNP:57537103
complement(3925)-t, cdbSNP:200446935
complement(4069)-t, gdbSNP:55654722
complement(4083)-g, adbSNP:181043252
complement(4141)-t, gdbSNP:201228201
complement(4147)-, tdbSNP:10710687
complement(4147)-t, gdbSNP:78388152
complement(4188)-c, adbSNP:189674977
complement(4238)-g, adbSNP:143111263
complement(4263)-c, adbSNP:185142391
complement(4290)-g, adbSNP:112919605
complement(4309)-t, cdbSNP:10021014
complement(4355)-t, cdbSNP:10013891
complement(4364)-t, cdbSNP:10020994
complement(4410)-t, cdbSNP:10011545
complement(4419)-t, cdbSNP:1794439
complement(4419)-dbSNP:71180191
complement(4465)-t, cdbSNP:34898817
complement(4474)-t, cdbSNP:112243122
complement(4518)-g, adbSNP:13129335
complement(4520)-t, cdbSNP:71608286
complement(4575)-t, cdbSNP:62272701
complement(4584)-t, cdbSNP:13149433
complement(4630)-t, cdbSNP:138631611
complement(4633)-c, adbSNP:56124515
complement(4685)-g, adbSNP:1610579
complement(4694)-t, cdbSNP:112896469
complement(4740)-t, cdbSNP:9761583
complement(4795)-g, adbSNP:1730764
complement(4848)-g, adbSNP:112287766
complement(4850)-t, cdbSNP:6821400
complement(4903)-g, adbSNP:10002108
complement(4906)-t, cdbSNP:1730765
complement(4922)-g, adbSNP:188771294
complement(4934)-g, adbSNP:116619832
complement(4935)-t, cdbSNP:58673626
complement(4939)-t, cdbSNP:184901788
complement(4952)-g, adbSNP:192641295
complement(5013)-c, adbSNP:145409422
complement(5060)-g, adbSNP:186626917
complement(5071)-t, adbSNP:182301878
complement(5091)-g, adbSNP:10001975
complement(5092)-t, cdbSNP:140310151
complement(5122)-g, adbSNP:191304628
complement(5131)-g, adbSNP:187928350
complement(5175)-t, cdbSNP:116213946
complement(5176)-g, adbSNP:146693994
complement(5190)-t, cdbSNP:143195082
complement(5214)-g, adbSNP:114048770
complement(5218)-g, adbSNP:183387675
complement(5245)-t, cdbSNP:3183
complement(5256)-t, cdbSNP:140688401
complement(5262)-t, cdbSNP:3182
complement(5273)-g, adbSNP:191578245
complement(5279)-t, cdbSNP:114126711
complement(5346)-g, adbSNP:3184
complement(5398)-c, adbSNP:187147956
complement(5400)-t, gdbSNP:181753831
complement(5445)-g, cdbSNP:79595315
complement(5492)-g, adbSNP:150921784
complement(5529)-g, adbSNP:142985904
complement(5556)-g, adbSNP:1730766
complement(5567)-g, adbSNP:77567558
complement(5591)-t, cdbSNP:75458081
complement(5622..5623)-, adbSNP:140865416
complement(5632)-c, adbSNP:75953505
complement(5898)-c, adbSNP:11729369
complement(5993..5994)-, gdbSNP:34439113
complement(6117)-t, cdbSNP:190904722
complement(6122)-t, cdbSNP:184973663
complement(6180)-t, cdbSNP:147521522
complement(6261)-g, cdbSNP:180909447
complement(6343)-t, cdbSNP:11727559
complement(6375..6376)-, adbSNP:34336383
complement(6377..6378)-, adbSNP:142015082
complement(6379)-t, cdbSNP:189588469
complement(6442)-g, cdbSNP:144821798
complement(6457)-g, adbSNP:140847247
complement(6459)-t, gdbSNP:77081441
complement(6515..6537)-, aagtttttaactgtattatcccadbSNP:79227311
complement(6518..6539)-, ccaagtttttaactgtattatcdbSNP:142051974
complement(6539)-, ccaagtttttaactgtattatcdbSNP:150717047
complement(6600)-g, adbSNP:71608285
complement(6601)-t, cdbSNP:2858029
complement(6641)-t, adbSNP:201250734
complement(6642)-c, adbSNP:200200445
complement(6643..6644)-, cattadbSNP:57367734
complement(6643)-t, cdbSNP:201746395
complement(6645)-t, cdbSNP:113781752
complement(6647..6648)-, cattadbSNP:66472443
complement(6649..6650)-, tacatdbSNP:33963422
complement(6650..6651)-, tacatdbSNP:10625329
complement(6653)-t, gdbSNP:201223435
complement(6707)-g, adbSNP:28547570
complement(6726)-t, gdbSNP:184652721
complement(6763)-t, gdbSNP:28410166
complement(6912..6913)-, adbSNP:200813321
complement(6936)-g, cdbSNP:149579808
complement(6943)-c, adbSNP:138162585
complement(6995)-c, adbSNP:150812194
complement(7071)-c, adbSNP:181591817
complement(7079..7080)-, adbSNP:199728200
complement(7118)-g, adbSNP:189946350
complement(7133)-t, gdbSNP:184559590
complement(7159)-t, cdbSNP:192346356
complement(7189)-g, adbSNP:2699403
complement(7246)-t, cdbSNP:6839714
complement(7269)-t, cdbSNP:55916136
complement(7406)-g, adbSNP:189543874
complement(7439)-c, adbSNP:138119054
complement(7455)-g, adbSNP:183656076
complement(7518)-g, adbSNP:6820191
complement(7526)-t, cdbSNP:192242230
complement(7572)-g, adbSNP:188058551
complement(7687)-t, cdbSNP:59333061
complement(7709)-t, gdbSNP:182971157
complement(7738)-t, cdbSNP:192936489
complement(7745)-t, gdbSNP:74622705
complement(7757)-, tdbSNP:200593210
complement(7860)-g, cdbSNP:187215793
complement(7864)-t, cdbSNP:78294484
complement(8008)-t, cdbSNP:78869014
complement(8052)-t, gdbSNP:74717941
complement(8116..8117)-, adbSNP:59614185
complement(8117..8118)-, adbSNP:112943416
complement(8293)-t, cdbSNP:143086286
complement(8339)-t, gdbSNP:77298395
complement(8380)-g, adbSNP:149051042
complement(8474)-c, adbSNP:149867039
complement(8477)-t, cdbSNP:140653273
complement(8479)-c, adbSNP:147951440
complement(8536)-g, cdbSNP:144860657
complement(8540)-t, cdbSNP:140939243
complement(8559..8560)-, tggaadbSNP:35219735
complement(8612)-g, cdbSNP:2858028
complement(8642)-g, adbSNP:147291715
complement(8655)-t, cdbSNP:182959094
complement(8673)-g, adbSNP:16844488
complement(8680)-g, adbSNP:73793965
complement(8739)-t, adbSNP:73080991
complement(8883)-g, adbSNP:112021500
complement(8927)-g, adbSNP:2858027
complement(8967)-t, cdbSNP:142872977
complement(8993)-t, adbSNP:184159402
complement(9013)-t, cdbSNP:148523862
complement(9049)-t, cdbSNP:2858026
complement(9098)-t, cdbSNP:73080986
complement(9172..9173)-, gaadbSNP:33990871
complement(9173..9174)-, gaadbSNP:10665176
complement(9173)-g, adbSNP:201748988
complement(9174..9175)-, aag, gaadbSNP:34765033
complement(9175..9176)-, aagdbSNP:141156680
complement(9175..9176)-, aag, gaadbSNP:142484341
complement(9176)-t, gdbSNP:77205235
complement(9178..9179)-, aatdbSNP:201057670
complement(9179)-t, adbSNP:79380656
complement(9207)-g, adbSNP:144701176
complement(9369)-, t, tttdbSNP:71180190
complement(9397..9398)-, tgagdbSNP:61489246
complement(9398..9399)-, gtdbSNP:200242782
complement(9400..9401)-, tgagdbSNP:35250116
complement(9401..9402)-, tgagdbSNP:140400481
complement(9420)-g, cdbSNP:2858025
complement(9555)-t, cdbSNP:200353970
complement(9557)-c, adbSNP:138150633
complement(9646)-t, cdbSNP:6836064
complement(9678)-g, adbSNP:56358267
complement(9730)-g, cdbSNP:190768436
complement(9754)-t, cdbSNP:186244367
complement(9871)-g, adbSNP:9999697
complement(9898)-g, adbSNP:141814662
complement(9952)-, cdbSNP:35270999
complement(9962)-t, cdbSNP:181119674
complement(9970)-g, adbSNP:189845654
complement(10013)-c, adbSNP:11723071
complement(10092)-g, cdbSNP:138690847
complement(10098)-t, gdbSNP:35553977
complement(10110)-t, gdbSNP:56298218
complement(10127)-g, adbSNP:185976081
complement(10203)-c, adbSNP:140780854
complement(10212)-g, adbSNP:148007403
complement(10224)-t, cdbSNP:117135297
complement(10256)-t, cdbSNP:56027744
complement(10351)-g, adbSNP:181642062
complement(10370)-t, adbSNP:143461417
complement(10384)-g, adbSNP:141111838
complement(10390)-g, adbSNP:189189387
complement(10411)-t, cdbSNP:184908846
complement(10412)-g, adbSNP:3468
complement(10486)-g, adbSNP:193296400
Gene SymbolLRPAP1
Gene SynonymA2MRAP; A2RAP; HBP44; MRAP; RAP
Chromosome4
Locus Map4p16.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002337 Homo sapiens low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), mRNA. In-stock $418.00 $369.00 10
Title Cholesterol metabolism gene polymorphisms and the risk of biliary tract cancers and stones: a population-based case-control study in Shanghai, China .
Author Xu,H.L., Cheng,J.R., Andreotti,G., Gao,Y.T., Rashid,A., Wang,B.S., Shen,M.C., Chu,L.W., Yu,K. and Hsing,A.W.
Journal Carcinogenesis 32 (1), 58-62 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Lack of interaction between LRP1 and A2M polymorphisms for the risk of Alzheimer disease .
Author Bruno,E., Quattrocchi,G., Nicoletti,A., Le Pira,F., Maci,T., Mostile,G., Andreoli,V., Quattrone,A. and Zappia,M.
Journal Neurosci. Lett. 482 (2), 112-116 (2010)
Title Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer .
Author Lipkin,S.M., Chao,E.C., Moreno,V., Rozek,L.S., Rennert,H., Pinchev,M., Dizon,D., Rennert,G., Kopelovich,L. and Gruber,S.B.
Journal Cancer Prev Res (Phila) 3 (5), 597-603 (2010)
Title Association of genetic variants with hemorrhagic stroke in Japanese individuals .
Author Yoshida,T., Kato,K., Yokoi,K., Oguri,M., Watanabe,S., Metoki,N., Yoshida,H., Satoh,K., Aoyagi,Y., Nozawa,Y. and Yamada,Y.
Journal Int. J. Mol. Med. 25 (4), 649-656 (2010)
Title The 39-kDa receptor-associated protein interacts with two members of the low density lipoprotein receptor family, alpha 2-macroglobulin receptor and glycoprotein 330 .
Author Kounnas,M.Z., Argraves,W.S. and Strickland,D.K.
Journal J. Biol. Chem. 267 (29), 21162-21166 (1992)
Title A novel mechanism for controlling the activity of alpha 2-macroglobulin receptor/low density lipoprotein receptor-related protein. Multiple regulatory sites for 39-kDa receptor-associated protein .
Author Williams,S.E., Ashcom,J.D., Argraves,W.S. and Strickland,D.K.
Journal J. Biol. Chem. 267 (13), 9035-9040 (1992)
Title 39-kDa protein modulates binding of ligands to low density lipoprotein receptor-related protein/alpha 2-macroglobulin receptor .
Author Herz,J., Goldstein,J.L., Strickland,D.K., Ho,Y.K. and Brown,M.S.
Journal J. Biol. Chem. 266 (31), 21232-21238 (1991)
Title Primary structure of alpha 2-macroglobulin receptor-associated protein. Human homologue of a Heymann nephritis antigen .
Author Strickland,D.K., Ashcom,J.D., Williams,S., Battey,F., Behre,E., McTigue,K., Battey,J.F. and Argraves,W.S.
Journal J. Biol. Chem. 266 (20), 13364-13369 (1991)
Title A heparin binding protein whose expression increases during differentiation of embryonal carcinoma cells to parietal endoderm cells: cDNA cloning and sequence analysis .
Author Furukawa,T., Ozawa,M., Huang,R.P. and Muramatsu,T.
Journal J. Biochem. 108 (2), 297-302 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.