• THAT   AND
  • THAT   AND


Homo sapiens low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002337 Homo sapiens low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), mRNA. Full Lenth $459.94
ORF Sequence $311.46


RefSeq Version NM_002337.2, 194440683
Length 1586 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), mRNA.
Product alpha-2-macroglobulin receptor-associated protein precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DB035408.1, BC112067.1, BX647984.1 and AK222504.1. On Jul 25, 2008 this sequence version replaced gi:4505020.

RefSeq NP_002328.1
CDS 86..1159
Exon (1)1..289
Exon (2)1..289
Exon (3)290..434
Exon (4)435..556
Exon (5)557..677
Exon (6)678..836
Exon (7)837..919
Exon (8)920..1096
Exon (9)1097..1570
Translation MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLN QLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILA KYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHK EKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRR VSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEI AHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(33..34)-, gdbSNP:35394575
complement(61..62)-, cgdbSNP:3082915
68+c, gdbSNP:1800483
complement(104)-t, cdbSNP:17848316
complement(275)-g, cdbSNP:11940827
complement(306)-t, adbSNP:55856346
383+g, tdbSNP:11549511
423+a, gdbSNP:11549516
426+a, gdbSNP:2228158
432+a, gdbSNP:34897511
complement(504)-t, cdbSNP:115292967
532+c, tdbSNP:11549513
680+a, gdbSNP:35108689
complement(716)-g, cdbSNP:111244551
835+c, tdbSNP:11549515
835+c, tdbSNP:13325
1015+c, tdbSNP:11549512
1016+a, gdbSNP:1800493
1024+c, tdbSNP:35919694
1165+c, tdbSNP:6789
1166+c, tdbSNP:1801136
1171+a, gdbSNP:1800495
complement(1192)-t, cdbSNP:76983628
complement(1247)-t, cdbSNP:55683554
complement(1258)-t, adbSNP:113953397
complement(1285)-t, cdbSNP:74877511
complement(1305)-t, cdbSNP:115035174
1321+c, tdbSNP:1049574
1356+g, tdbSNP:1802967
complement(1435)-g, adbSNP:113801833
1446+g, tdbSNP:17848281
1457+c, tdbSNP:1049608
complement(1492)-t, adbSNP:77768479
complement(1544)-t, adbSNP:9995685
Gene SymbolLRPAP1
Gene SynonymA2MRAP; A2RAP; HBP44; MGC138272; MRAP; RAP
Chromosome4
Locus Map4p16.3
All Transcripts NM_002337
Title Cholesterol metabolism gene polymorphisms and the risk of biliary tract cancers and stones: a population-based case-control study in Shanghai, China .
Author Xu,H.L., Cheng,J.R., Andreotti,G., Gao,Y.T., Rashid,A., Wang,B.S., Shen,M.C., Chu,L.W., Yu,K. and Hsing,A.W.
Journal Carcinogenesis 32 (1), 58-62 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Lack of interaction between LRP1 and A2M polymorphisms for the risk of Alzheimer disease .
Author Bruno,E., Quattrocchi,G., Nicoletti,A., Le Pira,F., Maci,T., Mostile,G., Andreoli,V., Quattrone,A. and Zappia,M.
Journal Neurosci. Lett. 482 (2), 112-116 (2010)
Title Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer .
Author Lipkin,S.M., Chao,E.C., Moreno,V., Rozek,L.S., Rennert,H., Pinchev,M., Dizon,D., Rennert,G., Kopelovich,L. and Gruber,S.B.
Journal Cancer Prev Res (Phila) 3 (5), 597-603 (2010)
Title Association of genetic variants with hemorrhagic stroke in Japanese individuals .
Author Yoshida,T., Kato,K., Yokoi,K., Oguri,M., Watanabe,S., Metoki,N., Yoshida,H., Satoh,K., Aoyagi,Y., Nozawa,Y. and Yamada,Y.
Journal Int. J. Mol. Med. 25 (4), 649-656 (2010)
Title The 39-kDa receptor-associated protein interacts with two members of the low density lipoprotein receptor family, alpha 2-macroglobulin receptor and glycoprotein 330 .
Author Kounnas,M.Z., Argraves,W.S. and Strickland,D.K.
Journal J. Biol. Chem. 267 (29), 21162-21166 (1992)
Title A novel mechanism for controlling the activity of alpha 2-macroglobulin receptor/low density lipoprotein receptor-related protein. Multiple regulatory sites for 39-kDa receptor-associated protein .
Author Williams,S.E., Ashcom,J.D., Argraves,W.S. and Strickland,D.K.
Journal J. Biol. Chem. 267 (13), 9035-9040 (1992)
Title 39-kDa protein modulates binding of ligands to low density lipoprotein receptor-related protein/alpha 2-macroglobulin receptor .
Author Herz,J., Goldstein,J.L., Strickland,D.K., Ho,Y.K. and Brown,M.S.
Journal J. Biol. Chem. 266 (31), 21232-21238 (1991)
Title Primary structure of alpha 2-macroglobulin receptor-associated protein. Human homologue of a Heymann nephritis antigen .
Author Striekland,D.K., Ashcom,J.D., Williams,S., Battey,F., Behre,E., McTigue,K., Battey,J.F. and Argraves,W.S.
Journal J. Biol. Chem. 266 (20), 13364-13369 (1991)
Title A heparin binding protein whose expression increases during differentiation of embryonal carcinoma cells to parietal endoderm cells: cDNA cloning and sequence analysis .
Author Furukawa,T., Ozawa,M., Huang,R.P. and Muramatsu,T.
Journal J. Biochem. 108 (2), 297-302 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878