• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002337 Homo sapiens low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_002337.3, 336595168
Length 10536 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), transcript variant 1, mRNA.
Product alpha-2-macroglobulin receptor-associated protein precursor
Comment

Summary: This gene encodes a protein that interacts with the low density lipoprotein (LDL) receptor-related protein and facilitates its proper folding and localization by preventing the binding of ligands. Mutations in this gene have been identified in individuals with myopia 23. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013].


Transcript Variant: This variant (1) represents the longer transcript and encodes the protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002328.1
CDS 86..1159
Misc Feature(1)50..52
Misc Feature(2)155..487
Misc Feature(3)374..376
Misc Feature(4)515..1156
Exon (1)1..289
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
Exon (2)290..434
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
Exon (3)435..556
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
Exon (4)557..677
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
Exon (5)678..836
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
Exon (6)837..919
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
Exon (7)920..1096
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
Exon (8)1097..10536
Gene:LRPAP1
Gene Synonym:A2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
Translation MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLN QLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILA KYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHK EKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRR VSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEI AHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(33..34)-dbSNP:
complement(33..34)-, gdbSNP:35394575
complement(61..62)-, cgdbSNP:3082915
complement(65)-g, adbSNP:141001956
68+c, gdbSNP:1800483
complement(75)-t, gdbSNP:373858485
complement(76)-c, adbSNP:371652192
complement(77)-g, adbSNP:368685421
complement(90)-g, adbSNP:375417190
complement(94)-g, cdbSNP:374848233
complement(104)-t, cdbSNP:17848316
complement(106)-t, cdbSNP:201770716
complement(113)-g, cdbSNP:370866898
complement(118)-g, adbSNP:200330132
complement(166)-g, adbSNP:139828333
complement(173)-t, adbSNP:201806719
complement(195)-g, cdbSNP:148017639
complement(232)-g, cdbSNP:377668697
complement(275)-g, cdbSNP:11940827
complement(287)-g, adbSNP:142940249
complement(292)-dbSNP:
complement(292)-t, cdbSNP:200867938
complement(304)-g, adbSNP:148553602
complement(306)-t, adbSNP:55856346
complement(307)-t, cdbSNP:373510897
complement(310)-t, cdbSNP:369933980
complement(316)-g, adbSNP:377473977
complement(353)-t, cdbSNP:146399188
complement(359)-t, c, adbSNP:142211110
383+a, g, tdbSNP:11549511
complement(397)-g, adbSNP:139103216
complement(412)-t, cdbSNP:142669297
complement(414)-g, cdbSNP:201485938
complement(422)-g, adbSNP:371563601
423+a, gdbSNP:11549516
426+a, gdbSNP:2228158
432+a, gdbSNP:34897511
complement(460)-dbSNP:
complement(460)-t, gdbSNP:150108954
complement(473)-t, cdbSNP:141746328
complement(477)-t, cdbSNP:367608534
complement(485)-t, adbSNP:374080649
complement(504)-t, cdbSNP:190769048
complement(518)-t, cdbSNP:138080464
complement(520)-t, cdbSNP:147013302
532+c, tdbSNP:11549513
complement(550)-c, adbSNP:202126851
complement(551)-g, adbSNP:141393177
complement(564)-dbSNP:
complement(564)-g, adbSNP:368431663
complement(580)-g, adbSNP:373275995
complement(581)-t, cdbSNP:143848774
complement(583)-g, adbSNP:143257814
complement(637)-t, g, adbSNP:149133766
complement(645)-t, cdbSNP:145265768
complement(680)-dbSNP:
complement(680)-g, adbSNP:35108689
complement(680)-g, adbSNP:386451435
complement(686)-t, cdbSNP:374011051
complement(700)-g, adbSNP:199600966
complement(716)-t, g, cdbSNP:111244551
complement(723)-t, gdbSNP:140204942
complement(726)-t, cdbSNP:374664239
complement(733)-g, adbSNP:138236468
complement(745)-t, cdbSNP:146148546
complement(750)-g, adbSNP:142076491
complement(771)-t, cdbSNP:148604784
complement(800)-g, adbSNP:376919981
complement(801)-t, cdbSNP:202048919
complement(814)-g, adbSNP:200151667
complement(823)-g, adbSNP:370957737
835+c, tdbSNP:13325
complement(842)-dbSNP:
complement(842)-t, cdbSNP:368226243
complement(876)-g, adbSNP:374220727
complement(883)-g, cdbSNP:149473926
complement(917)-g, adbSNP:138120743
complement(918)-t, cdbSNP:192009446
948..949+dbSNP:
948..949+, tcdbSNP:398122836
complement(987)-g, adbSNP:201384451
complement(988)-t, c, adbSNP:200532799
complement(991)-g, adbSNP:374981655
complement(1015)-t, cdbSNP:11549512
1016+a, gdbSNP:1800493
1024+c, tdbSNP:35919694
complement(1032)-t, cdbSNP:372003322
complement(1033)-c, adbSNP:150160443
complement(1036)-t, cdbSNP:201496652
complement(1046)-g, adbSNP:200424526
complement(1047)-t, cdbSNP:140947105
complement(1054)-t, cdbSNP:374454307
complement(1058)-t, cdbSNP:148077268
complement(1064)-g, cdbSNP:200159569
complement(1074)-t, cdbSNP:143714310
complement(1095)-g, c, adbSNP:140565543
complement(1124)-dbSNP:
complement(1124)-t, cdbSNP:368995062
complement(1143)-t, cdbSNP:146814560
complement(1145)-g, cdbSNP:143841560
complement(1150)-g, adbSNP:141943482
complement(1151)-t, cdbSNP:141338615
complement(1164)-t, cdbSNP:148120809
1165..1166+c, tdbSNP:1801136
1165+c, tdbSNP:6789
1171+a, gdbSNP:1800495
complement(1180)-g, adbSNP:188271252
complement(1192)-t, cdbSNP:76983628
complement(1198)-g, adbSNP:200127365
complement(1246)-g, adbSNP:183983595
complement(1247)-t, cdbSNP:55683554
complement(1258)-t, adbSNP:113953397
complement(1317)-t, cdbSNP:376223749
1321+c, tdbSNP:1049574
1356+g, tdbSNP:1802967
complement(1435)-g, adbSNP:113801833
1446+g, tdbSNP:17848281
1457+c, tdbSNP:1049608
complement(1485)-c, adbSNP:371446293
complement(1492)-t, adbSNP:77768479
complement(1516)-t, cdbSNP:139057451
complement(1544)-t, adbSNP:9995685
complement(1618)-c, adbSNP:377047499
1623+g, tdbSNP:1794438
complement(1631)-t, cdbSNP:2077130
complement(1633)-g, adbSNP:191853111
complement(1700)-g, adbSNP:10024301
complement(1727)-g, adbSNP:116622990
complement(1774)-c, adbSNP:730748
complement(1811)-t, cdbSNP:62272702
complement(1812)-t, gdbSNP:188505547
complement(1917)-g, adbSNP:185183975
complement(1924)-t, cdbSNP:112750320
complement(1958)-g, adbSNP:372804654
complement(1959)-t, cdbSNP:111558413
complement(1973)-t, cdbSNP:193226384
complement(1990)-g, adbSNP:3021475
2019+c, tdbSNP:1741554
2026+a, gdbSNP:2093098
2048..2100+dbSNP:71180192
complement(2053)-g, adbSNP:113572632
complement(2072)-g, adbSNP:7442071
complement(2079)-t, cdbSNP:7436998
2080+a, gdbSNP:1730761
complement(2106)-g, adbSNP:1794432
complement(2125)-g, adbSNP:13126792
complement(2132)-t, cdbSNP:112453164
complement(2133)-t, cdbSNP:13112088
complement(2149)-g, adbSNP:731819
complement(2159)-g, adbSNP:7442035
complement(2184)-g, adbSNP:13126754
complement(2185)-t, cdbSNP:111382803
complement(2186)-t, cdbSNP:13112054
complement(2202)-g, adbSNP:28699606
complement(2212)-g, adbSNP:111983747
complement(2217)-t, cdbSNP:112673739
complement(2237)-g, adbSNP:3897706
complement(2238)-t, cdbSNP:112366599
complement(2239)-t, cdbSNP:2014440
complement(2265)-g, adbSNP:113444648
complement(2290)-g, adbSNP:36101076
complement(2317)-t, cdbSNP:13146489
complement(2361)-g, adbSNP:2014431
complement(2365)-t, cdbSNP:2014430
complement(2380)-t, cdbSNP:183521495
complement(2386)-g, cdbSNP:189755673
complement(2405..2406)-, gggaadbSNP:398072062
complement(2410..2411)-, gggaadbSNP:78712138
complement(2415)-g, adbSNP:186967986
complement(2419)-t, cdbSNP:140821121
complement(2437)-t, gdbSNP:150975210
complement(2470)-g, adbSNP:28444167
complement(2487)-c, adbSNP:182634517
complement(2494)-t, cdbSNP:375835700
complement(2604..2605)-, gdbSNP:35931653
complement(2606)-g, adbSNP:113960400
complement(2642)-c, adbSNP:190269929
2655+c, gdbSNP:1741555
2735+c, tdbSNP:1741556
complement(2756)-t, cdbSNP:144053967
complement(2822)-g, cdbSNP:76598271
complement(2924)-t, adbSNP:374291359
complement(3010)-g, adbSNP:146668093
complement(3170)-t, cdbSNP:1794424
complement(3173)-g, cdbSNP:377320052
complement(3216)-g, adbSNP:143154769
complement(3248)-t, cdbSNP:186773036
complement(3297)-t, cdbSNP:1794423
complement(3331)-t, gdbSNP:6848039
complement(3342)-g, adbSNP:181800416
complement(3371)-g, cdbSNP:6818522
complement(3381)-g, cdbSNP:192029686
complement(3390..3391)-, agatdbSNP:139078926
complement(3432)-g, adbSNP:73197125
complement(3467)-g, adbSNP:187115059
complement(3468)-t, cdbSNP:148809456
complement(3491)-t, cdbSNP:75577696
complement(3524)-t, cdbSNP:10014674
complement(3564)-t, adbSNP:182039375
complement(3583)-c, adbSNP:374226988
complement(3587)-t, cdbSNP:144377775
complement(3658)-g, adbSNP:371132516
complement(3712)-g, adbSNP:188126355
complement(3723)-t, cdbSNP:10014466
complement(3781)-g, adbSNP:149622962
complement(3876)-t, cdbSNP:35350183
complement(3917)-g, adbSNP:57537103
complement(3925)-t, cdbSNP:200446935
complement(4011)-t, cdbSNP:373207822
complement(4069)-t, gdbSNP:55654722
complement(4083)-g, adbSNP:181043252
4141+, adbSNP:397715647
complement(4141)-t, gdbSNP:201228201
complement(4147)-, tdbSNP:10710687
complement(4147)-t, gdbSNP:78388152
complement(4188)-c, adbSNP:189674977
complement(4238)-g, adbSNP:143111263
complement(4263)-c, adbSNP:185142391
complement(4265)-t, cdbSNP:369404322
complement(4290)-g, adbSNP:112919605
complement(4300)-t, cdbSNP:375307678
complement(4309)-t, cdbSNP:10021014
complement(4355)-t, cdbSNP:10013891
complement(4364)-t, cdbSNP:10020994
complement(4410)-t, cdbSNP:10011545
complement(4419)-t, cdbSNP:1794439
complement(4465)-t, cdbSNP:34898817
complement(4474)-t, cdbSNP:112243122
complement(4518)-g, adbSNP:13129335
complement(4520)-t, cdbSNP:71608286
complement(4529)-t, cdbSNP:112896469
complement(4575)-t, cdbSNP:62272701
complement(4584)-t, cdbSNP:13149433
complement(4630)-t, cdbSNP:138631611
complement(4633)-c, adbSNP:56124515
complement(4685)-g, adbSNP:1610579
complement(4740)-t, cdbSNP:9761583
complement(4795)-g, adbSNP:1730764
complement(4841)-t, cdbSNP:373988038
complement(4848)-g, adbSNP:112287766
complement(4850)-t, cdbSNP:6821400
complement(4903)-g, adbSNP:10002108
4906+c, tdbSNP:1730765
complement(4922)-g, adbSNP:188771294
complement(4934)-g, adbSNP:116619832
complement(4935)-t, cdbSNP:58673626
complement(4939)-t, cdbSNP:184901788
complement(4952)-g, adbSNP:192641295
complement(5003)-c, adbSNP:372711666
5013+a, cdbSNP:145409422
complement(5046)-g, adbSNP:369245719
complement(5060)-g, adbSNP:186626917
complement(5071)-t, adbSNP:182301878
complement(5091)-g, adbSNP:10001975
complement(5092)-t, cdbSNP:140310151
complement(5122)-g, adbSNP:191304628
complement(5131)-g, adbSNP:187928350
complement(5175)-t, cdbSNP:116213946
complement(5176)-g, adbSNP:146693994
complement(5190)-t, cdbSNP:143195082
complement(5214)-g, adbSNP:114048770
complement(5218)-g, adbSNP:183387675
5245+c, tdbSNP:3183
complement(5256)-t, cdbSNP:140688401
5262+c, tdbSNP:3182
complement(5273)-g, adbSNP:191578245
complement(5279)-t, cdbSNP:114126711
complement(5310)-g, cdbSNP:370867174
5346+a, gdbSNP:3184
complement(5398)-c, adbSNP:187147956
complement(5400)-t, gdbSNP:181753831
complement(5445)-g, cdbSNP:79595315
complement(5492)-g, adbSNP:150921784
complement(5529)-g, adbSNP:142985904
complement(5550)-g, adbSNP:372895350
5556+a, gdbSNP:1730766
complement(5567)-g, adbSNP:77567558
complement(5591)-t, cdbSNP:75458081
complement(5622..5623)-, adbSNP:140865416
complement(5632)-c, adbSNP:75953505
complement(5752)-g, adbSNP:377394871
complement(5898)-c, adbSNP:11729369
complement(5991..5992)-, gdbSNP:34439113
complement(6117)-t, cdbSNP:190904722
complement(6122)-t, cdbSNP:184973663
complement(6180)-t, cdbSNP:147521522
complement(6261)-g, cdbSNP:180909447
complement(6343)-t, cdbSNP:11727559
6366..6367+, tdbSNP:397992134
complement(6376..6377)-, adbSNP:34336383
complement(6379)-t, cdbSNP:189588469
complement(6442)-g, cdbSNP:144821798
complement(6457)-g, adbSNP:140847247
complement(6459)-t, gdbSNP:77081441
complement(6515..6537)-, aagtttttaactgtattatcccadbSNP:79227311
complement(6515..6536)-, agtttttaactgtattatcccadbSNP:375297891
complement(6518..6539)-, ccaagtttttaactgtattatcdbSNP:142051974
complement(6518)-c, adbSNP:372767283
complement(6577)-t, cdbSNP:369870305
complement(6600)-g, adbSNP:71608285
complement(6601)-t, cdbSNP:2858029
complement(6641)-t, adbSNP:201250734
complement(6642)-c, adbSNP:200200445
complement(6643..6644)-, catta, catcadbSNP:57367734
complement(6643)-t, cdbSNP:201746395
complement(6645)-t, cdbSNP:113781752
complement(6647..6648)-, cattadbSNP:386399086
complement(6648..6649)-, cattadbSNP:369724779
complement(6649..6650)-, tacatdbSNP:33963422
complement(6650..6651)-, tacatdbSNP:10625329
complement(6653)-t, gdbSNP:201223435
complement(6707)-g, adbSNP:28547570
complement(6726)-t, gdbSNP:184652721
complement(6763)-t, gdbSNP:28410166
complement(6897..6901)-, caagadbSNP:377662486
complement(6912..6913)-, adbSNP:200813321
complement(6936)-g, cdbSNP:149579808
complement(6943)-c, adbSNP:138162585
complement(6946..6947)-, ctdbSNP:367683773
complement(6995)-c, adbSNP:150812194
complement(7071)-c, adbSNP:181591817
complement(7079..7080)-, adbSNP:199728200
complement(7118)-g, adbSNP:189946350
complement(7133)-t, gdbSNP:184559590
complement(7159)-t, cdbSNP:192346356
7189+a, gdbSNP:2699403
complement(7246)-t, cdbSNP:6839714
complement(7269)-t, cdbSNP:55916136
complement(7406)-g, adbSNP:189543874
complement(7427)-t, adbSNP:371122487
complement(7439)-c, adbSNP:138119054
complement(7455)-g, adbSNP:183656076
complement(7518)-g, adbSNP:6820191
complement(7526)-t, cdbSNP:192242230
complement(7572)-g, adbSNP:188058551
complement(7687)-t, cdbSNP:59333061
complement(7709)-t, gdbSNP:182971157
complement(7738)-t, cdbSNP:192936489
complement(7745)-t, gdbSNP:74622705
complement(7757)-, tdbSNP:200593210
complement(7860)-g, cdbSNP:187215793
complement(7864)-t, cdbSNP:78294484
complement(8008)-t, cdbSNP:78869014
complement(8052)-t, gdbSNP:74717941
complement(8107..8108)-, adbSNP:397690484
complement(8116..8117)-, adbSNP:59614185
complement(8293)-t, cdbSNP:143086286
complement(8339)-t, gdbSNP:77298395
complement(8380)-g, adbSNP:149051042
complement(8452)-g, adbSNP:368551596
complement(8474)-c, adbSNP:149867039
complement(8477)-t, cdbSNP:140653273
complement(8479)-c, adbSNP:147951440
complement(8518..8520)-gctacc, ctadbSNP:386670703
complement(8536)-g, cdbSNP:144860657
complement(8540)-t, cdbSNP:140939243
complement(8612)-g, cdbSNP:2858028
complement(8616)-g, adbSNP:375374932
complement(8642)-g, adbSNP:147291715
complement(8655)-t, cdbSNP:182959094
complement(8673)-g, adbSNP:16844488
complement(8680)-g, adbSNP:73793965
complement(8739)-t, adbSNP:73080991
complement(8747)-g, cdbSNP:370445747
complement(8785)-t, cdbSNP:372650261
complement(8883)-g, adbSNP:112021500
complement(8922)-g, adbSNP:377055951
complement(8927)-g, adbSNP:2858027
complement(8967)-t, cdbSNP:142872977
complement(8993)-t, adbSNP:184159402
complement(9013)-t, cdbSNP:148523862
complement(9049)-t, cdbSNP:2858026
complement(9098)-t, cdbSNP:73080986
complement(9173..9174)-, gaadbSNP:10665176
complement(9173)-g, adbSNP:201748988
complement(9174..9175)-, aag, gaadbSNP:34765033
complement(9175..9176)-, aag, gaadbSNP:141156680
complement(9176)-t, gdbSNP:77205235
complement(9178..9179)-, aatdbSNP:201057670
complement(9179)-t, adbSNP:79380656
complement(9207)-g, adbSNP:144701176
complement(9344)-c, adbSNP:368893230
9369+, tdbSNP:71180190
complement(9397..9398)-, tgagdbSNP:397797132
complement(9398..9399)-, gtdbSNP:200242782
complement(9400..9401)-, tgagdbSNP:367924853
complement(9400..9401)-, tgagdbSNP:386399085
complement(9401..9402)-, tgagdbSNP:61489246
complement(9420)-g, cdbSNP:2858025
complement(9555)-t, cdbSNP:200353970
complement(9557)-c, adbSNP:138150633
complement(9586)-t, cdbSNP:373392763
complement(9646)-t, cdbSNP:6836064
complement(9678)-g, adbSNP:56358267
complement(9730)-g, cdbSNP:190768436
complement(9754)-t, cdbSNP:186244367
complement(9871)-g, adbSNP:9999697
complement(9898)-g, adbSNP:141814662
complement(9950)-, cdbSNP:35270999
complement(9962)-t, cdbSNP:181119674
complement(9970)-g, adbSNP:189845654
complement(10013)-c, adbSNP:11723071
complement(10090)-t, cdbSNP:374993976
complement(10092)-g, cdbSNP:138690847
complement(10098)-t, gdbSNP:35553977
complement(10110)-t, gdbSNP:56298218
complement(10127)-g, adbSNP:185976081
complement(10203)-c, adbSNP:140780854
complement(10212)-g, adbSNP:148007403
complement(10224)-t, cdbSNP:117135297
complement(10256)-t, cdbSNP:56027744
complement(10351)-g, adbSNP:181642062
complement(10370)-t, adbSNP:143461417
complement(10384)-g, adbSNP:141111838
complement(10390)-g, adbSNP:189189387
complement(10393)-g, adbSNP:372697288
complement(10406)-g, adbSNP:369860374
complement(10411)-t, cdbSNP:184908846
complement(10412)-t, cdbSNP:386582799
complement(10412)-g, adbSNP:3468
complement(10418)-t, cdbSNP:367732281
complement(10486)-g, adbSNP:193296400
Gene SymbolLRPAP1
Gene SynonymA2MRAP; A2RAP; alpha-2-MRAP; HBP44; MRAP; MYP23; RAP
Chromosome4
Locus Map4p16.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002337 Homo sapiens low density lipoprotein receptor-related protein associated protein 1 (LRPAP1), transcript variant 1, mRNA. In-stock $418.00 $369.00 10
Title Discovery and refinement of loci associated with lipid levels .
Author Willer CJ, Schmidt EM, Sengupta S, Peloso GM, Gustafsson S, Kanoni S, Ganna A, Chen J, Buchkovich ML, Mora S, Beckmann JS, Bragg-Gresham JL, Chang HY, Demirkan A, Den Hertog HM, Do R, Donnelly LA, Ehret GB, Esko T, Feitosa MF, Ferreira T, Fischer K, Fontanillas P, Fraser RM, Freitag DF, Gurdasani D, Heikkila K, Hypponen E, Isaacs A, Jackson AU, Johansson A, Johnson T, Kaakinen M, Kettunen J, Kleber ME, Li X, Luan J, Lyytikainen LP, Magnusson PK, Mangino M, Mihailov E, Montasser ME, Muller-Nurasyid M, Nolte IM, O'Connell JR, Palmer CD, Perola M, Petersen AK, Sanna S, Saxena R, Service SK, Shah S, Shungin D, Sidore C, Song C, Strawbridge RJ, Surakka I, Tanaka T, Teslovich TM, Thorleifsson G, Van den Herik EG, Voight BF, Volcik KA, Waite LL, Wong A, Wu Y, Zhang W, Absher D, Asiki G, Barroso I, Been LF, Bolton JL, Bonnycastle LL, Brambilla P, Burnett MS, Cesana G, Dimitriou M, Doney AS, Doring A, Elliott P, Epstein SE, Eyjolfsson GI, Gigante B, Goodarzi MO, Grallert H, Gravito ML, Groves CJ, Hallmans G, Hartikainen AL, Hayward C, Hernandez D, Hicks AA, Holm H, Hung YJ, Illig T, Jones MR, Kaleebu P, Kastelein JJ, Khaw KT, Kim E, Klopp N, Komulainen P, Kumari M, Langenberg C, Lehtimaki T, Lin SY, Lindstrom J, Loos RJ, Mach F, McArdle WL, Meisinger C, Mitchell BD, Muller G, Nagaraja R, Narisu N, Nieminen TV, Nsubuga RN, Olafsson I, Ong KK, Palotie A, Papamarkou T, Pomilla C, Pouta A, Rader DJ, Reilly MP, Ridker PM, Rivadeneira F, Rudan I, Ruokonen A, Samani N, Scharnagl H, Seeley J, Silander K, Stancakova A, Stirrups K, Swift AJ, Tiret L, Uitterlinden AG, van Pelt LJ, Vedantam S, Wainwright N, Wijmenga C, Wild SH, Willemsen G, Wilsgaard T, Wilson JF, Young EH, Zhao JH, Adair LS, Arveiler D, Assimes TL, Bandinelli S, Bennett F, Bochud M, Boehm BO, Boomsma DI, Borecki IB, Bornstein SR, Bovet P, Burnier M, Campbell H, Chakravarti A, Chambers JC, Chen YD, Collins FS, Cooper RS, Danesh J, Dedoussis G, de Faire U, Feranil AB, Ferrieres J, Ferrucci L, Freimer NB, Gieger C, Groop LC, Gudnason V, Gyllensten U, Hamsten A, Harris TB, Hingorani A, Hirschhorn JN, Hofman A, Hovingh GK, Hsiung CA, Humphries SE, Hunt SC, Hveem K, Iribarren C, Jarvelin MR, Jula A, Kahonen M, Kaprio J, Kesaniemi A, Kivimaki M, Kooner JS, Koudstaal PJ, Krauss RM, Kuh D, Kuusisto J, Kyvik KO, Laakso M, Lakka TA, Lind L, Lindgren CM, Martin NG, Marz W, McCarthy MI, McKenzie CA, Meneton P, Metspalu A, Moilanen L, Morris AD, Munroe PB, Njolstad I, Pedersen NL, Power C, Pramstaller PP, Price JF, Psaty BM, Quertermous T, Rauramaa R, Saleheen D, Salomaa V, Sanghera DK, Saramies J, Schwarz PE, Sheu WH, Shuldiner AR, Siegbahn A, Spector TD, Stefansson K, Strachan DP, Tayo BO, Tremoli E, Tuomilehto J, Uusitupa M, van Duijn CM, Vollenweider P, Wallentin L, Wareham NJ, Whitfield JB, Wolffenbuttel BH, Ordovas JM, Boerwinkle E, Palmer CN, Thorsteinsdottir U, Chasman DI, Rotter JI, Franks PW, Ripatti S, Cupples LA, Sandhu MS, Rich SS, Boehnke M, Deloukas P, Kathiresan S, Mohlke KL, Ingelsson E and Abecasis GR.
Journal Nat. Genet. 45 (11), 1274-1283 (2013)
Title Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease .
Author Sabater-Lleal M, Huang J, Chasman D, Naitza S, Dehghan A, Johnson AD, Teumer A, Reiner AP, Folkersen L, Basu S, Rudnicka AR, Trompet S, Malarstig A, Baumert J, Bis JC, Guo X, Hottenga JJ, Shin SY, Lopez LM, Lahti J, Tanaka T, Yanek LR, Oudot-Mellakh T, Wilson JF, Navarro P, Huffman JE, Zemunik T, Redline S, Mehra R, Pulanic D, Rudan I, Wright AF, Kolcic I, Polasek O, Wild SH, Campbell H, Curb JD, Wallace R, Liu S, Eaton CB, Becker DM, Becker LC, Bandinelli S, Raikkonen K, Widen E, Palotie A, Fornage M, Green D, Gross M, Davies G, Harris SE, Liewald DC, Starr JM, Williams FM, Grant PJ, Spector TD, Strawbridge RJ, Silveira A, Sennblad B, Rivadeneira F, Uitterlinden AG, Franco OH, Hofman A, van Dongen J, Willemsen G, Boomsma DI, Yao J, Swords Jenny N, Haritunians T, McKnight B, Lumley T, Taylor KD, Rotter JI, Psaty BM, Peters A, Gieger C, Illig T, Grotevendt A, Homuth G, Volzke H, Kocher T, Goel A, Franzosi MG, Seedorf U, Clarke R, Steri M, Tarasov KV, Sanna S, Schlessinger D, Stott DJ, Sattar N, Buckley BM, Rumley A, Lowe GD, McArdle WL, Chen MH, Tofler GH, Song J, Boerwinkle E, Folsom AR, Rose LM, Franco-Cereceda A, Teichert M, Ikram MA, Mosley TH, Bevan S, Dichgans M, Rothwell PM, Sudlow CL, Hopewell JC, Chambers JC, Saleheen D, Kooner JS, Danesh J, Nelson CP, Erdmann J, Reilly MP, Kathiresan S, Schunkert H, Morange PE, Ferrucci L, Eriksson JG, Jacobs D, Deary IJ, Soranzo N, Witteman JC, de Geus EJ, Tracy RP, Hayward C, Koenig W, Cucca F, Jukema JW, Eriksson P, Seshadri S, Markus HS, Watkins H, Samani NJ, Wallaschofski H, Smith NL, Tregouet D, Ridker PM, Tang W, Strachan DP, Hamsten A and O'Donnell CJ.
Journal Circulation 128 (12), 1310-1324 (2013)
Title Mutations in LRPAP1 are associated with severe myopia in humans .
Author Aldahmesh MA, Khan AO, Alkuraya H, Adly N, Anazi S, Al-Saleh AA, Mohamed JY, Hijazi H, Prabakaran S, Tacke M, Al-Khrashi A, Hashem M, Reinheckel T, Assiri A and Alkuraya FS.
Journal Am. J. Hum. Genet. 93 (2), 313-320 (2013)
Title Receptor-associated protein blocks internalization and cytotoxicity of myeloma light chain in cultured human proximal tubular cells .
Author Sengul S, Erturk S, Khan AM and Batuman V.
Journal PLoS ONE 8 (7), E70276 (2013)
Title Cloning, characterization, and chromosomal localization to 4p16 of the human gene (LRPAP1) coding for the alpha 2-macroglobulin receptor-associated protein and structural comparison with the murine gene coding for the 44-kDa heparin-binding protein .
Author Van Leuven F, Hilliker C, Serneels L, Umans L, Overbergh L, De Strooper B, Fryns JP and Van den Berghe H.
Journal Genomics 25 (2), 492-500 (1995)
Title The 39-kDa receptor-associated protein interacts with two members of the low density lipoprotein receptor family, alpha 2-macroglobulin receptor and glycoprotein 330 .
Author Kounnas MZ, Argraves WS and Strickland DK.
Journal J. Biol. Chem. 267 (29), 21162-21166 (1992)
Title A novel mechanism for controlling the activity of alpha 2-macroglobulin receptor/low density lipoprotein receptor-related protein. Multiple regulatory sites for 39-kDa receptor-associated protein .
Author Williams SE, Ashcom JD, Argraves WS and Strickland DK.
Journal J. Biol. Chem. 267 (13), 9035-9040 (1992)
Title 39-kDa protein modulates binding of ligands to low density lipoprotein receptor-related protein/alpha 2-macroglobulin receptor .
Author Herz J, Goldstein JL, Strickland DK, Ho YK and Brown MS.
Journal J. Biol. Chem. 266 (31), 21232-21238 (1991)
Title Primary structure of alpha 2-macroglobulin receptor-associated protein. Human homologue of a Heymann nephritis antigen .
Author Strickland DK, Ashcom JD, Williams S, Battey F, Behre E, McTigue K, Battey JF and Argraves WS.
Journal J. Biol. Chem. 266 (20), 13364-13369 (1991)
Title A heparin binding protein whose expression increases during differentiation of embryonal carcinoma cells to parietal endoderm cells: cDNA cloning and sequence analysis .
Author Furukawa T, Ozawa M, Huang RP and Muramatsu T.
Journal J. Biochem. 108 (2), 297-302 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.