• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lymphotoxin beta receptor (TNFR superfamily, member 3) (LTBR), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_002342 Homo sapiens lymphotoxin beta receptor (TNFR superfamily, member 3) (LTBR), transcript variant 1, mRNA. ORF Sequence $379.32
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002342.2, 402534563
Length 2283 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens lymphotoxin beta receptor (TNFR superfamily, member 3) (LTBR), transcript variant 1, mRNA.
Product tumor necrosis factor receptor superfamily member 3 isoform 1 precursor
Comment

Summary: This gene encodes a member of the tumor necrosis factor receptor superfamily. The major ligands of this receptor include lymphotoxin alpha/beta and tumor necrosis factor ligand superfamily member 14. The encoded protein plays a role in signalling during the development of lymphoid and other organs, lipid metabolism, immune response, and programmed cell death. Activity of this receptor has also been linked to carcinogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Aug 2012].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_002333.1
CDS 327..1634
Misc Feature(1)210..212
Misc Feature(2)477..764
Misc Feature(3)order(504..533,558..572,675..683)
Misc Feature(4)order(504..506,516..518,522..524,561..563,570..572,
Misc Feature(5)order(588..590,621..623,654..656,720..722,750..752)
Misc Feature(6)order(597..602,618..626)
Misc Feature(7)720..>956
Misc Feature(8)order(720..725,849..851,882..884,912..914)
Misc Feature(9)order(720..722,750..764)
Misc Feature(10)order(732..734,762..764,774..776,780..782,822..824,
Misc Feature(11)order(762..788,792..794,819..833,933..941)
Misc Feature(12)order(858..863,879..887)
Exon (1)1..422
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (2)423..519
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (3)520..645
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (4)646..798
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (5)799..895
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (6)896..993
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (7)994..1101
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (8)1102..1127
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (9)1128..1356
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (10)1357..2268
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Translation MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCS RCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKR KTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLL ATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGD VSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGN IYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGA TPSNRGPRNQFITHD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
51+dbSNP:
51+a, cdbSNP:12827109
58+a, cdbSNP:12827112
153+a, gdbSNP:10849448
170+c, tdbSNP:180813649
243+c, tdbSNP:41512347
316+a, gdbSNP:112422948
326+c, tdbSNP:201263587
442+dbSNP:
442+a, gdbSNP:113907340
482+a, gdbSNP:11555387
486+c, gdbSNP:147291553
572+dbSNP:
572+a, gdbSNP:41480749
596+a, gdbSNP:144676461
602+g, tdbSNP:1042318
679+dbSNP:
679+a, gdbSNP:200343421
710+a, gdbSNP:41489647
763+c, tdbSNP:41393248
814+dbSNP:
814+a, gdbSNP:149981490
827+c, tdbSNP:199745608
828+a, gdbSNP:145130663
842+a, cdbSNP:2364480
866+c, tdbSNP:41335846
870+a, cdbSNP:113334413
872+c, tdbSNP:144218663
877+a, gdbSNP:199917609
944+dbSNP:
944+c, tdbSNP:140294576
982+c, tdbSNP:185897139
1011+dbSNP:
1011+g, tdbSNP:41332645
1014+a, gdbSNP:190288182
1053+a, gdbSNP:148007184
1093+a, gdbSNP:141647006
1105+dbSNP:
1105+c, tdbSNP:150503607
1146+dbSNP:
1146+c, tdbSNP:35681405
1186+c, tdbSNP:74400611
1212+c, tdbSNP:11555386
1228+c, tdbSNP:144056108
1235+a, gdbSNP:147770937
1239+c, tdbSNP:140869621
1247+a, gdbSNP:201042007
1253+a, gdbSNP:34407931
1258+c, tdbSNP:144755581
1283+a, gdbSNP:148530627
1321+a, gdbSNP:1804534
1466+dbSNP:
1466+c, tdbSNP:202215602
1507+c, tdbSNP:142824360
1518+c, tdbSNP:3764872
1582+g, tdbSNP:151029798
1636+g, tdbSNP:12354
1732+c, gdbSNP:41355445
1733+c, gdbSNP:3203555
1747+c, tdbSNP:184319376
1753+a, gdbSNP:71584824
1760+a, gdbSNP:35986933
1819+c, tdbSNP:12820636
1882+c, tdbSNP:149078929
1942+c, tdbSNP:71584825
1980+a, cdbSNP:3764870
2010+g, tdbSNP:181205105
2259+a, cdbSNP:3176984
2264+a, gdbSNP:3180974
Gene SymbolLTBR
Gene SynonymCD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Chromosome12
Locus Map12p13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001270987 Homo sapiens lymphotoxin beta receptor (TNFR superfamily, member 3) (LTBR), transcript variant 2, mRNA. Full Length $605.52
ORF Sequence $362.79
NM_002342 Homo sapiens lymphotoxin beta receptor (TNFR superfamily, member 3) (LTBR), transcript variant 1, mRNA. Full Length $662.07
ORF Sequence $379.32
Title Association between lymphotoxin beta receptor gene polymorphisms and IgA nephropathy in Korean children .
Author Kim,S.K., Lee,J.Y., Jeong Park,H., Chung,J.H., Suh,J.S., Hahn,W.H., Cho,B.S. and Kim,M.J.
Journal Immunol. Invest. 41 (5), 447-457 (2012)
Title Biology and signal transduction pathways of the Lymphotoxin-alphabeta/LTbetaR system .
Author Remouchamps,C., Boutaffala,L., Ganeff,C. and Dejardin,E.
Journal Cytokine Growth Factor Rev. 22 (5-6), 301-310 (2011)
Title LTbetaR signaling in dendritic cells induces a type I IFN response that is required for optimal clonal expansion of CD8+ T cells .
Author Summers deLuca,L., Ng,D., Gao,Y., Wortzman,M.E., Watts,T.H. and Gommerman,J.L.
Journal Proc. Natl. Acad. Sci. U.S.A. 108 (5), 2046-2051 (2011)
Title Adiponectin inhibits lymphotoxin-beta receptor-mediated NF-kappaB signaling in human umbilical vein endothelial cells .
Author Xu,Y., Zhang,C., Wang,N., Ling,F., Li,P., Gao,Y. and Hua,W.
Journal Biochem. Biophys. Res. Commun. 404 (4), 1060-1064 (2011)
Title Lymphotoxin-beta receptor blockade reduces CXCL13 in lacrimal glands and improves corneal integrity in the NOD model of Sjogren's syndrome .
Author Fava,R.A., Kennedy,S.M., Wood,S.G., Bolstad,A.I., Bienkowska,J., Papandile,A., Kelly,J.A., Mavragani,C.P., Gatumu,M., Skarstein,K. and Browning,J.L.
Journal Arthritis Res. Ther. 13 (6), R182 (2011)
Title TRAF5, an activator of NF-kappaB and putative signal transducer for the lymphotoxin-beta receptor .
Author Nakano,H., Oshima,H., Chung,W., Williams-Abbott,L., Ware,C.F., Yagita,H. and Okumura,K.
Journal J. Biol. Chem. 271 (25), 14661-14664 (1996)
Title Signaling through the lymphotoxin beta receptor induces the death of some adenocarcinoma tumor lines .
Author Browning,J.L., Miatkowski,K., Sizing,I., Griffiths,D., Zafari,M., Benjamin,C.D., Meier,W. and Mackay,F.
Journal J. Exp. Med. 183 (3), 867-878 (1996)
Title Isolation and regional assignment of human chromosome 12p cDNAs .
Author Baens,M., Aerssens,J., van Zand,K., Van den Berghe,H. and Marynen,P.
Journal Genomics 29 (1), 44-52 (1995)
Title A lymphotoxin-beta-specific receptor .
Author Crowe,P.D., VanArsdale,T.L., Walter,B.N., Ware,C.F., Hession,C., Ehrenfels,B., Browning,J.L., Din,W.S., Goodwin,R.G. and Smith,C.A.
Journal Science 264 (5159), 707-710 (1994)
Title Construction and evaluation of a hncDNA library of human 12p transcribed sequences derived from a somatic cell hybrid .
Author Baens,M., Chaffanet,M., Cassiman,J.J., van den Berghe,H. and Marynen,P.
Journal Genomics 16 (1), 214-218 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878