• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lymphotoxin beta receptor (TNFR superfamily, member 3) (LTBR), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu16923 Homo sapiens lymphotoxin beta receptor (TNFR superfamily, member 3) (LTBR), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu16923C Homo sapiens lymphotoxin beta receptor (TNFR superfamily, member 3) (LTBR), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002342.2, 402534563
Length 1308 bp
Structure linear
Update Date 20-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens lymphotoxin beta receptor (TNFR superfamily, member 3) (LTBR), transcript variant 1, mRNA.
Product tumor necrosis factor receptor superfamily member 3 isoform 1 precursor
Comment

Summary: This gene encodes a member of the tumor necrosis factor receptor superfamily. The major ligands of this receptor include lymphotoxin alpha/beta and tumor necrosis factor ligand superfamily member 14. The encoded protein plays a role in signalling during the development of lymphoid and other organs, lipid metabolism, immune response, and programmed cell death. Activity of this receptor has also been linked to carcinogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Aug 2012].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_002333.1
CDS 327..1634
Misc Feature(1)210..212
Misc Feature(2)453..764
Misc Feature(3)order(453..458,588..590,621..623,654..656,720..722,
Misc Feature(4)order(465..467,504..506,516..518,522..524,561..563,
Misc Feature(5)order(504..533,558..572,675..683)
Misc Feature(6)order(597..602,618..626)
Misc Feature(7)order(720..722,750..764)
Misc Feature(8)768..>956
Misc Feature(9)order(768..788,792..794,819..833,933..941)
Misc Feature(10)order(774..776,780..782,822..824,831..833,861..863)
Misc Feature(11)order(858..863,879..887)
Exon (1)1..422
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (2)423..519
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (3)520..645
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (4)646..798
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (5)799..895
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (6)896..993
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (7)994..1101
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (8)1102..1127
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (9)1128..1356
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Exon (10)1357..2268
Gene:LTBR
Gene Synonym:CD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Translation MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCS RCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKR KTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLL ATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGD VSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGN IYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGA TPSNRGPRNQFITHD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
51+dbSNP:
51+a, cdbSNP:12827109
58+a, cdbSNP:12827112
153+a, gdbSNP:10849448
170+c, tdbSNP:180813649
243+c, tdbSNP:41512347
316+a, gdbSNP:112422948
326+c, tdbSNP:201263587
386+c, tdbSNP:375428958
442+dbSNP:
442+a, gdbSNP:113907340
482+a, gdbSNP:11555387
486+c, gdbSNP:147291553
572+dbSNP:
572+a, gdbSNP:41480749
586+c, tdbSNP:267603628
596+a, gdbSNP:144676461
602+g, tdbSNP:1042318
656+dbSNP:
656+c, gdbSNP:376062437
679+a, gdbSNP:200343421
699+c, tdbSNP:371101623
710+a, gdbSNP:41489647
763+c, tdbSNP:41393248
814+dbSNP:
814+a, gdbSNP:149981490
827+c, tdbSNP:199745608
828+a, gdbSNP:145130663
842+a, cdbSNP:2364480
866+c, tdbSNP:41335846
870+a, cdbSNP:113334413
872+c, tdbSNP:144218663
877+a, gdbSNP:199917609
944+dbSNP:
944+c, tdbSNP:140294576
965+a, tdbSNP:374274216
970+a, gdbSNP:368496847
982+c, tdbSNP:185897139
1008+dbSNP:
1008+c, gdbSNP:372316101
1011+g, tdbSNP:41332645
1014+a, gdbSNP:190288182
1052+c, tdbSNP:369186345
1053+a, gdbSNP:148007184
1064+c, tdbSNP:372115715
1093+a, gdbSNP:141647006
1105+dbSNP:
1105+c, tdbSNP:150503607
complement(1146)-dbSNP:
complement(1146)-t, cdbSNP:35681405
complement(1186)-t, cdbSNP:74400611
1212+c, tdbSNP:11555386
1228+c, tdbSNP:144056108
1235+a, gdbSNP:147770937
1239+c, tdbSNP:140869621
1247+a, gdbSNP:201042007
1253+a, gdbSNP:34407931
1253+c, tdbSNP:386447374
1258+c, tdbSNP:144755581
1283+a, gdbSNP:148530627
1285+a, gdbSNP:370657088
1321+a, gdbSNP:1804534
1331+c, tdbSNP:374220510
1340+c, gdbSNP:368425660
1394+dbSNP:
1394+c, tdbSNP:375470015
1466+c, tdbSNP:202215602
1507+c, tdbSNP:142824360
complement(1518)-t, cdbSNP:3764872
1518+c, tdbSNP:386585792
1613+a, cdbSNP:376201696
1635+a, cdbSNP:369367670
1636+g, tdbSNP:12354
1651+g, tdbSNP:371743773
1676+c, tdbSNP:374817713
1719+g, tdbSNP:367847000
1732+c, gdbSNP:41355445
1733+c, gdbSNP:3203555
1747+c, tdbSNP:184319376
1753+a, gdbSNP:71584824
1760+a, gdbSNP:35986933
1819+c, tdbSNP:12820636
complement(1882)-t, cdbSNP:149078929
1942+c, tdbSNP:71584825
1980+a, cdbSNP:3764870
2010+g, tdbSNP:181205105
2259+a, cdbSNP:3176984
2264+a, gdbSNP:3180974
Gene SymbolLTBR
Gene SynonymCD18; D12S370; LT-BETA-R; TNF-R-III; TNFCR; TNFR-RP; TNFR2-RP; TNFR3; TNFRSF3
Chromosome12
Locus Map12p13
Title Pillars article: A lymphotoxin-B-specific receptor. Science. 1994. 264: 707-710 .
Author Crowe,P.D., Vanarsdale,T.L., Walter,B.N., Ware,C.F., Hession,C., Ehrenfels,B., Browning,J.L., Din,W.S., Goodwin,R.G. and Smith,C.A.
Journal J. Immunol. 192 (5), 2015-2018 (2014)
Title Dimerization of LTbetaR by LTalpha1beta2 is necessary and sufficient for signal transduction .
Author Sudhamsu J, Yin J, Chiang EY, Starovasnik MA, Grogan JL and Hymowitz SG.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (49), 19896-19901 (2013)
Title Lymphotoxin signalling in immune homeostasis and the control of microorganisms .
Author Upadhyay V and Fu YX.
Journal Nat. Rev. Immunol. 13 (4), 270-279 (2013)
Title Association between lymphotoxin beta receptor gene polymorphisms and IgA nephropathy in Korean children .
Author Kim SK, Lee JY, Jeong Park H, Chung JH, Suh JS, Hahn WH, Cho BS and Kim MJ.
Journal Immunol. Invest. 41 (5), 447-457 (2012)
Title Biology and signal transduction pathways of the Lymphotoxin-alphabeta/LTbetaR system .
Author Remouchamps C, Boutaffala L, Ganeff C and Dejardin E.
Journal Cytokine Growth Factor Rev. 22 (5-6), 301-310 (2011)
Title TRAF5, an activator of NF-kappaB and putative signal transducer for the lymphotoxin-beta receptor .
Author Nakano H, Oshima H, Chung W, Williams-Abbott L, Ware CF, Yagita H and Okumura K.
Journal J. Biol. Chem. 271 (25), 14661-14664 (1996)
Title Signaling through the lymphotoxin beta receptor induces the death of some adenocarcinoma tumor lines .
Author Browning JL, Miatkowski K, Sizing I, Griffiths D, Zafari M, Benjamin CD, Meier W and Mackay F.
Journal J. Exp. Med. 183 (3), 867-878 (1996)
Title Isolation and regional assignment of human chromosome 12p cDNAs .
Author Baens M, Aerssens J, van Zand K, Van den Berghe H and Marynen P.
Journal Genomics 29 (1), 44-52 (1995)
Title A lymphotoxin-beta-specific receptor .
Author Crowe PD, VanArsdale TL, Walter BN, Ware CF, Hession C, Ehrenfels B, Browning JL, Din WS, Goodwin RG and Smith CA.
Journal Science 264 (5159), 707-710 (1994)
Title Construction and evaluation of a hncDNA library of human 12p transcribed sequences derived from a somatic cell hybrid .
Author Baens M, Chaffanet M, Cassiman JJ, van den Berghe H and Marynen P.
Journal Genomics 16 (1), 214-218 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.