• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens MAS1 oncogene (MAS1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002377 Homo sapiens MAS1 oncogene (MAS1), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_002377.2, 6006022
Length 1135 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens MAS1 oncogene (MAS1), mRNA.
Product proto-oncogene Mas
Comment

Summary: This gene encodes a class I seven-transmembrane G-protein-coupled receptor. The encoded protein is a receptor for angiotensin-(1-7) and preferentially couples to the Gq protein, activating the phospholipase C signaling pathway. The encoded protein may play a role in multiple processes including hypotension, smooth muscle relaxation and cardioprotection by mediating the effects of angiotensin-(1-7). [provided by RefSeq, May 2012].

RefSeq NP_002368.1
CDS 15..992
Misc Feature(1)3..5
Misc Feature(2)123..197
Misc Feature(3)123..197
Misc Feature(4)180..854
Misc Feature(5)210..272
Misc Feature(6)327..398
Misc Feature(7)462..530
Misc Feature(8)570..632
Misc Feature(9)687..749
Misc Feature(10)804..866
Exon (1)1..1135
Gene:MAS1
Gene Synonym:MAS
Translation MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT RAFKDEMQPRRQKDNCNTVTVETVV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Gene SymbolMAS1
Gene SynonymMAS
Chromosome6
Locus Map6q25.3-q26
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002377 Homo sapiens MAS1 oncogene (MAS1), mRNA. In-stock $418.00 $369.00 10
Title Therapeutic targeting of the angiotensin-converting enzyme 2/Angiotensin-(1-7)/Mas cascade in the renin-angiotensin system: a patent review .
Author Ferreira,A.J., Bader,M. and Santos,R.A.
Journal Expert Opin Ther Pat 22 (5), 567-574 (2012)
Title Inhibition of Mas G-protein signaling improves coronary blood flow, reduces myocardial infarct size, and provides long-term cardioprotection .
Author Zhang,T., Li,Z., Dang,H., Chen,R., Liaw,C., Tran,T.A., Boatman,P.D., Connolly,D.T. and Adams,J.W.
Journal Am. J. Physiol. Heart Circ. Physiol. 302 (1), H299-H311 (2012)
Title Angiotensin-(1-7)-mediated signaling in cardiomyocytes .
Author Gomes,E.R., Santos,R.A. and Guatimosim,S.
Journal Int J Hypertens 2012, 493129 (2012)
Title Angiotensin converting enzyme 2, Angiotensin-(1-7), and receptor .
Author Pinheiro,S.V. and Simoes E Silva,A.C.
Journal Int J Hypertens 2012, 414128 (2012)
Title New cardiovascular and pulmonary therapeutic strategies based on the Angiotensin-converting enzyme 2/angiotensin-(1-7)/mas receptor axis .
Author Ferreira,A.J., Murca,T.M., Fraga-Silva,R.A., Castro,C.H., Raizada,M.K. and Santos,R.A.
Journal Int J Hypertens 2012, 147825 (2012)
Title Biosynthetic pathways and the role of the MAS receptor in the effects of Angiotensin-(1-7) in smooth muscles .
Author Fressatto de Godoy,M.A., Pernomian,L., de Oliveira,A.M. and Rattan,S.
Journal Int J Hypertens 2012, 121740 (2012)
Title Angiotensin-(1-7) is an endogenous ligand for the G protein-coupled receptor Mas .
Author Santos,R.A., Simoes e Silva,A.C., Maric,C., Silva,D.M., Machado,R.P., de Buhr,I., Heringer-Walther,S., Pinheiro,S.V., Lopes,M.T., Bader,M., Mendes,E.P., Lemos,V.S., Campagnole-Santos,M.J., Schultheiss,H.P., Speth,R. and Walther,T.
Journal Proc. Natl. Acad. Sci. U.S.A. 100 (14), 8258-8263 (2003)
Title Molecular and cell biology of angiotensin receptors .
Author Hanley,M.R.
Journal J. Cardiovasc. Pharmacol. 18 (SUPPL 2), S7-S13 (1991)
Title The mas oncogene as a neural peptide receptor: expression, regulation and mechanism of action .
Author Hanley,M.R., Cheung,W.T., Hawkins,P., Poyner,D., Benton,H.P., Blair,L., Jackson,T.R. and Goedert,M.
Journal Ciba Found. Symp. 150, 23-38 (1990)
Title Human ros1 and mas1 oncogenes located in regions of chromosome 6 associated with tumor-specific rearrangements .
Author Rabin,M., Birnbaum,D., Young,D., Birchmeier,C., Wigler,M. and Ruddle,F.H.
Journal Oncogene Res. 1 (2), 169-178 (1987)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.