• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens MAS1 proto-oncogene, G protein-coupled receptor (MAS1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu28585 Homo sapiens MAS1 proto-oncogene, G protein-coupled receptor (MAS1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu28585C Homo sapiens MAS1 proto-oncogene, G protein-coupled receptor (MAS1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002377.2, 6006022
Length 978 bp
Structure linear
Update Date 28-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens MAS1 proto-oncogene, G protein-coupled receptor (MAS1), mRNA.
Product proto-oncogene Mas
Comment

Summary: This gene encodes a class I seven-transmembrane G-protein-coupled receptor. The encoded protein is a receptor for angiotensin-(1-7) and preferentially couples to the Gq protein, activating the phospholipase C signaling pathway. The encoded protein may play a role in multiple processes including hypotension, smooth muscle relaxation and cardioprotection by mediating the effects of angiotensin-(1-7). [provided by RefSeq, May 2012].

RefSeq NP_002368.1
CDS 15..992
Misc Feature(1)3..5
Misc Feature(2)123..197
Misc Feature(3)123..197
Misc Feature(4)180..854
Misc Feature(5)210..272
Misc Feature(6)327..398
Misc Feature(7)462..530
Misc Feature(8)<570..740
Misc Feature(9)570..632
Misc Feature(10)687..749
Misc Feature(11)804..866
Exon (1)1..1135
Gene:MAS1
Gene Synonym:MAS; MGRA
Translation MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT RAFKDEMQPRRQKDNCNTVTVETVV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
8+c, tdbSNP:191384214
30+a, gdbSNP:369549897
43+c, tdbSNP:377516639
52+a, tdbSNP:148810084
59+a, gdbSNP:111927070
71+c, tdbSNP:141410124
80+c, tdbSNP:201589978
89+c, tdbSNP:375747187
92+a, gdbSNP:367923994
116+c, tdbSNP:147446689
119+a, gdbSNP:139879171
135+a, tdbSNP:199916450
218+c, gdbSNP:145422711
221+c, tdbSNP:201287436
239+c, tdbSNP:374306384
254+a, gdbSNP:147698240
257+c, tdbSNP:188594906
274+c, tdbSNP:367886712
275+g, tdbSNP:191896350
306+g, tdbSNP:372604345
318+g, tdbSNP:139649334
337+c, tdbSNP:75396648
358+a, gdbSNP:149942969
365+c, tdbSNP:371805366
367+c, tdbSNP:145079703
382+c, tdbSNP:149100513
385+c, tdbSNP:142220585
407+a, cdbSNP:145130069
416+c, tdbSNP:140242572
448+c, tdbSNP:375732408
461+a, gdbSNP:190132211
477+c, tdbSNP:145329855
511+c, tdbSNP:201189349
530+c, tdbSNP:201944237
546+a, gdbSNP:137950570
555+c, tdbSNP:375222120
567+c, tdbSNP:201984343
568+a, gdbSNP:141043165
613+c, tdbSNP:138993417
639+a, gdbSNP:138897768
complement(647)-g, adbSNP:220721
657+c, tdbSNP:373003570
670+c, gdbSNP:138263796
677+c, gdbSNP:181740963
692+g, tdbSNP:187231524
696+a, gdbSNP:11968301
706+g, tdbSNP:377184807
706+, tdbSNP:35280463
714+a, gdbSNP:368888097
739+c, tdbSNP:142248825
769+a, gdbSNP:147267209
781+c, tdbSNP:373119084
782+a, gdbSNP:201516660
788+g, tdbSNP:377705823
815+c, tdbSNP:148754116
825+a, gdbSNP:371361677
836+c, tdbSNP:145623509
837+a, gdbSNP:142353056
859+c, tdbSNP:377679974
895+c, tdbSNP:139579440
918+a, gdbSNP:149736346
934+g, tdbSNP:370639629
938+a, gdbSNP:373837634
945+c, tdbSNP:146766270
946+a, gdbSNP:140222197
967+c, tdbSNP:148082809
976+a, tdbSNP:144013270
983+a, tdbSNP:146451067
986+c, tdbSNP:372960404
987+a, gdbSNP:149048594
1008+c, tdbSNP:112564811
1016+a, cdbSNP:369982265
1070+a, gdbSNP:189490097
Gene SymbolMAS1
Gene SynonymMAS; MGRA
Chromosome6
Locus Map6q25.3-q26
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002377 Homo sapiens MAS1 proto-oncogene, G protein-coupled receptor (MAS1), mRNA. In-stock $99.00 5-7
Title MAS promoter regulation: a role for Sry and tyrosine nitration of the KRAB domain of ZNF274 as a feedback mechanism .
Author Prokop JW, Rauscher FJ 3rd, Peng H, Liu Y, Araujo FC, Watanabe I, Reis FM and Milsted A.
Journal Clin. Sci. 126 (10), 727-738 (2014)
Title Comparative genomic analysis of eutherian Mas-related G protein-coupled receptor genes .
Author Premzl M.
Journal Gene 540 (1), 16-19 (2014)
Title Angiotensin-converting enzyme 2/angiotensin-(1-7)/Mas axis protects against lung fibrosis by inhibiting the MAPK/NF-kappaB pathway .
Author Meng Y, Yu CH, Li W, Li T, Luo W, Huang S, Wu PS, Cai SX and Li X.
Journal Am. J. Respir. Cell Mol. Biol. 50 (4), 723-736 (2014)
Title Control of adipogenesis by the autocrine interplays between angiotensin 1-7/Mas receptor and angiotensin II/AT1 receptor signaling pathways .
Author Than A, Leow MK and Chen P.
Journal J. Biol. Chem. 288 (22), 15520-15531 (2013)
Title Inhibition of Mas G-protein signaling improves coronary blood flow, reduces myocardial infarct size, and provides long-term cardioprotection .
Author Zhang T, Li Z, Dang H, Chen R, Liaw C, Tran TA, Boatman PD, Connolly DT and Adams JW.
Journal Am. J. Physiol. Heart Circ. Physiol. 302 (1), H299-H311 (2012)
Title Angiotensin converting enzyme 2, Angiotensin-(1-7), and receptor .
Author Pinheiro SV and Simoes E Silva AC.
Journal Int J Hypertens 2012, 414128 (2012)
Title Angiotensin-(1-7) is an endogenous ligand for the G protein-coupled receptor Mas .
Author Santos RA, Simoes e Silva AC, Maric C, Silva DM, Machado RP, de Buhr I, Heringer-Walther S, Pinheiro SV, Lopes MT, Bader M, Mendes EP, Lemos VS, Campagnole-Santos MJ, Schultheiss HP, Speth R and Walther T.
Journal Proc. Natl. Acad. Sci. U.S.A. 100 (14), 8258-8263 (2003)
Title Molecular and cell biology of angiotensin receptors .
Author Hanley MR.
Journal J. Cardiovasc. Pharmacol. 18 (SUPPL 2), S7-S13 (1991)
Title The mas oncogene as a neural peptide receptor: expression, regulation and mechanism of action .
Author Hanley MR, Cheung WT, Hawkins P, Poyner D, Benton HP, Blair L, Jackson TR and Goedert M.
Journal Ciba Found. Symp. 150, 23-38 (1990)
Title Human ros1 and mas1 oncogenes located in regions of chromosome 6 associated with tumor-specific rearrangements .
Author Rabin M, Birnbaum D, Young D, Birchmeier C, Wigler M and Ruddle FH.
Journal Oncogene Res. 1 (2), 169-178 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.