• THAT   AND
  • THAT   AND


Homo sapiens MAS1 oncogene (MAS1), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002377 Homo sapiens MAS1 oncogene (MAS1), mRNA. Full Lenth $329.15
ORF Sequence $283.62


RefSeq Version NM_002377.2, 6006022
Length 1135 bp
Structure linear
Update Date 13-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens MAS1 oncogene (MAS1), mRNA.
Product proto-oncogene Mas
Comment

Summary: The structure of the MAS1 product indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects. [provided by RefSeq].

RefSeq NP_002368.1
CDS 15..992
Exon (1)1..1135
Exon (2)1..1135
Translation MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT RAFKDEMQPRRQKDNCNTVTVETVV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
59+a, gdbSNP:111927070
337+c, tdbSNP:75396648
complement(647)-g, adbSNP:220721
696+a, gdbSNP:11968301
706+, tdbSNP:35280463
1008+c, tdbSNP:112564811
Gene SymbolMAS1
Gene SynonymMAS; MGC119966
Chromosome6
Locus Map6q25.3-q26
All Transcripts NM_002377
Title Angiotensin-(1-7), its receptor Mas, and the angiotensin-converting enzyme type 2 are expressed in the human ovary .
Author Reis,F.M., Bouissou,D.R., Pereira,V.M., Camargos,A.F., dos Reis,A.M. and Santos,R.A.
Journal Fertil. Steril. 95 (1), 176-181 (2011)
Title Interactions among related genes of renin-angiotensin system associated with type 2 diabetes .
Author Yang,J.K., Zhou,J.B., Xin,Z., Zhao,L., Yu,M., Feng,J.P., Yang,H. and Ma,Y.H.
Journal Diabetes Care 33 (10), 2271-2273 (2010)
Title Angiotensin (1-7) and its receptor Mas are expressed in the human testis: implications for male infertility .
Author Reis,A.B., Araujo,F.C., Pereira,V.M., Dos Reis,A.M., Santos,R.A. and Reis,F.M.
Journal J. Mol. Histol. 41 (1), 75-80 (2010)
Title Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling .
Author Trynka,G., Zhernakova,A., Romanos,J., Franke,L., Hunt,K.A., Turner,G., Bruinenberg,M., Heap,G.A., Platteel,M., Ryan,A.W., de Kovel,C., Holmes,G.K., Howdle,P.D., Walters,J.R., Sanders,D.S., Mulder,C.J., Mearin,M.L., Verbeek,W.H., Trimble,V., Stevens,F.M., Kelleher,D., Barisani,D., Bardella,M.T., McManus,R., van Heel,D.A. and Wijmenga,C.
Journal Gut 58 (8), 1078-1083 (2009)
Title Devil and angel in the renin-angiotensin system: ACE-angiotensin II-AT1 receptor axis vs. ACE2-angiotensin-(1-7)-Mas receptor axis .
Author Iwai,M. and Horiuchi,M.
Journal Hypertens. Res. 32 (7), 533-536 (2009)
Title The MAS proto-oncogene is not imprinted in humans .
Author Riesewijk,A.M., Schepens,M.T., Mariman,E.M., Ropers,H.H. and Kalscheuer,V.M.
Journal Genomics 35 (2), 380-382 (1996)
Title Molecular and cell biology of angiotensin receptors .
Author Hanley,M.R.
Journal J. Cardiovasc. Pharmacol. 18 SUPPL 2, S7-S13 (1991)
Title The mas oncogene as a neural peptide receptor: expression, regulation and mechanism of action .
Author Hanley,M.R., Cheung,W.T., Hawkins,P., Poyner,D., Benton,H.P., Blair,L., Jackson,T.R. and Goedert,M.
Journal Ciba Found. Symp. 150, 23-38 (1990)
Title Human ros1 and mas1 oncogenes located in regions of chromosome 6 associated with tumor-specific rearrangements .
Author Rabin,M., Birnbaum,D., Young,D., Birchmeier,C., Wigler,M. and Ruddle,F.H.
Journal Oncogene Res. 1 (2), 169-178 (1987)
Title Isolation and characterization of a new cellular oncogene encoding a protein with multiple potential transmembrane domains .
Author Young,D., Waitches,G., Birchmeier,C., Fasano,O. and Wigler,M.
Journal Cell 45 (5), 711-719 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878