• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002415 Homo sapiens macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mRNA. GenEZ ORF Cloning On-demand $299.00 14

*Business Day

Related Services

RefSeq Version NM_002415.1, 4505184
Length 561 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mRNA.
Product macrophage migration inhibitory factor
Comment

Summary: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008].

RefSeq NP_002406.1
CDS 98..445
Misc Feature(1)101..442
Misc Feature(2)101..442
Misc Feature(3)206..208
Misc Feature(4)329..331
Exon (1)1..205
Gene:MIF
Gene Synonym:GIF; GLIF; MMIF
Exon (2)206..378
Gene:MIF
Gene Synonym:GIF; GLIF; MMIF
Exon (3)379..561
Gene:MIF
Gene Synonym:GIF; GLIF; MMIF
Translation MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
16+dbSNP:
16+a, gdbSNP:34914548
24+a, tdbSNP:112568463
27+a, cdbSNP:17004038
36+a, cdbSNP:201326009
44+c, gdbSNP:201939799
45+c, gdbSNP:200266174
57+c, tdbSNP:200992026
64+a, gdbSNP:202123293
74+a, gdbSNP:149423910
76+g, tdbSNP:201359524
80+c, gdbSNP:199582661
81+c, tdbSNP:200428013
83+g, tdbSNP:1803649
90+c, tdbSNP:201249175
95+a, gdbSNP:199537781
102+c, gdbSNP:200500959
112+c, tdbSNP:201465617
140+a, gdbSNP:199714772
142+g, tdbSNP:11548057
144+c, tdbSNP:201862457
167+a, tdbSNP:200995600
172+a, gdbSNP:11548058
197+c, gdbSNP:201631604
201+c, tdbSNP:199980863
218+dbSNP:
218+c, tdbSNP:202066662
219+a, cdbSNP:200005486
228+a, gdbSNP:386518984
228+c, tdbSNP:11548059
239+a, gdbSNP:372575900
complement(244)-g, cdbSNP:11548055
272+c, tdbSNP:1049829
287+a, gdbSNP:201307782
295+c, tdbSNP:201952555
300+c, tdbSNP:11548056
308+c, gdbSNP:200394994
321+c, tdbSNP:182012324
340+c, tdbSNP:201837402
346+a, gdbSNP:200403178
352+c, gdbSNP:34060481
353+a, gdbSNP:201060788
355+a, gdbSNP:201099096
357+a, gdbSNP:376184469
359+c, tdbSNP:34733430
371+c, tdbSNP:201742529
372+c, gdbSNP:199774339
386+dbSNP:
386+a, gdbSNP:201792625
387+c, tdbSNP:372052137
393+a, gdbSNP:200286358
394+c, tdbSNP:201227875
414+a, gdbSNP:1803976
435+c, g, tdbSNP:139210892
436+c, gdbSNP:201956930
441+c, tdbSNP:200329745
450+c, tdbSNP:201417893
455+a, gdbSNP:35565661
456+a, gdbSNP:200824910
462+c, gdbSNP:201241742
468+c, tdbSNP:1050605
495+c, tdbSNP:376078573
496+g, tdbSNP:199587874
497+c, tdbSNP:200721210
500+a, g, tdbSNP:36065127
complement(508)-t, cdbSNP:3191127
509+c, tdbSNP:200174784
510+a, gdbSNP:200716985
512+c, gdbSNP:201740473
520+a, tdbSNP:200078978
528+c, tdbSNP:200980127
531+c, tdbSNP:3191218
542+a, cdbSNP:201308167
555+a, cdbSNP:199989428
559+a, gdbSNP:201104479
561+a, tdbSNP:112102057
Gene SymbolMIF
Gene SynonymGIF; GLIF; MMIF
Chromosome22
Locus Map22q11.23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002415 Homo sapiens macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mRNA. On-demand $299.00 14
Title Macrophage migration inhibitory factor deficiency in chronic obstructive pulmonary disease .
Author Sauler M, Leng L, Trentalange M, Haslip M, Shan P, Piecychna M, Zhang Y, Andrews N, Mannam P, Allore H, Fried T, Bucala R and Lee PJ.
Journal Am. J. Physiol. Lung Cell Mol. Physiol. 306 (6), L487-L496 (2014)
Title Dysregulated D-dopachrome tautomerase, a hypoxia-inducible factor-dependent gene, cooperates with macrophage migration inhibitory factor in renal tumorigenesis .
Author Pasupuleti V, Du W, Gupta Y, Yeh IJ, Montano M, Magi-Galuzzi C and Welford SM.
Journal J. Biol. Chem. 289 (6), 3713-3723 (2014)
Title MIF gene polymorphisms confer susceptibility to Vogt-Koyanagi-Harada syndrome in a Han Chinese population .
Author Zhang C, Liu S, Hou S, Lei B, Zheng X, Xiao X, Kijlstra A and Yang P.
Journal Invest. Ophthalmol. Vis. Sci. 54 (12), 7734-7738 (2013)
Title Macrophage migration inhibitory factor gene polymorphisms in inflammatory bowel disease: an association study in New Zealand Caucasians and meta-analysis .
Author Falvey JD, Bentley RW, Merriman TR, Hampton MB, Barclay ML, Gearry
Journal World J. Gastroenterol. 19 (39), 6656-6664 (2013)
Title Polymorphism and expression of macrophage migration inhibitory factor does not contribute to glucocorticoid resistance in idiopathic thrombocytopenic purpura .
Author Lao W, Xiang Y, Fang M and Yang X.
Journal Pharmazie 68 (10), 846-849 (2013)
Title Genomic cloning of mouse MIF (macrophage inhibitory factor) and genetic mapping of the human and mouse expressed gene and nine mouse pseudogenes .
Author Kozak CA, Adamson MC, Buckler CE, Segovia L, Paralkar V and Wistow G.
Journal Genomics 27 (3), 405-411 (1995)
Title The major binding protein of the interferon antagonist sarcolectin in human placenta is a macrophage migration inhibitory factor .
Author Zeng FY, Weiser WY, Kratzin H, Stahl B, Karas M and Gabius HJ.
Journal Arch. Biochem. Biophys. 303 (1), 74-80 (1993)
Title Human liver protein map: a reference database established by microsequencing and gel comparison .
Author Hochstrasser DF, Frutiger S, Paquet N, Bairoch A, Ravier F, Pasquali C, Sanchez JC, Tissot JD, Bjellqvist B and Vargas R.
Journal Electrophoresis 13 (12), 992-1001 (1992)
Title Molecular cloning of a cDNA encoding a human macrophage migration inhibitory factor .
Author Weiser WY, Temple PA, Witek-Giannotti JS, Remold HG, Clark SC and David JR.
Journal Proc. Natl. Acad. Sci. U.S.A. 86 (19), 7522-7526 (1989)
Title Glycolipid receptor for human migration inhibitory factor: fucose and sialic acid are important for the human monocyte response to migration inhibitory factor .
Author Liu,D.Y., Yu,S.F., Remold,H.G. and David,J.R.
Journal Cell. Immunol. 90 (2), 539-546 (1985)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.