• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mRNA.


RefSeq Accession Definition Services Price Order
NM_002415 Homo sapiens macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002415.1, 4505184
Length 561 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mRNA.
Product macrophage migration inhibitory factor
Comment

Summary: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008].

RefSeq NP_002406.1
CDS 98..445
Misc Feature(1)101..442
Misc Feature(2)101..442
Misc Feature(3)206..208
Misc Feature(4)329..331
Exon (1)1..205
Gene:MIF
Gene Synonym:GIF; GLIF; MMIF
Exon (2)206..378
Gene:MIF
Gene Synonym:GIF; GLIF; MMIF
Exon (3)379..561
Gene:MIF
Gene Synonym:GIF; GLIF; MMIF
Translation MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
16+dbSNP:
16+a, gdbSNP:34914548
24+a, tdbSNP:112568463
27+a, cdbSNP:17004038
36+a, cdbSNP:201326009
44+c, gdbSNP:201939799
45+c, gdbSNP:200266174
57+c, tdbSNP:200992026
64+a, gdbSNP:202123293
74+a, gdbSNP:149423910
76+g, tdbSNP:201359524
80+c, gdbSNP:199582661
81+c, tdbSNP:200428013
83+g, tdbSNP:1803649
90+c, tdbSNP:201249175
95+a, gdbSNP:199537781
102+c, gdbSNP:200500959
112+c, tdbSNP:201465617
140+a, gdbSNP:199714772
142+g, tdbSNP:11548057
144+c, tdbSNP:201862457
167+a, tdbSNP:200995600
172+a, gdbSNP:11548058
197+c, gdbSNP:201631604
201+c, tdbSNP:199980863
218+dbSNP:
218+c, tdbSNP:202066662
219+a, cdbSNP:200005486
228+c, tdbSNP:11548059
244+c, gdbSNP:11548055
272+c, tdbSNP:1049829
287+a, gdbSNP:201307782
295+c, tdbSNP:201952555
300+c, tdbSNP:11548056
308+c, gdbSNP:200394994
321+c, tdbSNP:182012324
340+c, tdbSNP:201837402
346+a, gdbSNP:200403178
352+c, gdbSNP:34060481
353+a, gdbSNP:201060788
355+a, gdbSNP:201099096
359+c, tdbSNP:34733430
371+c, tdbSNP:201742529
372+c, gdbSNP:199774339
386+dbSNP:
386+a, gdbSNP:201792625
393+a, gdbSNP:200286358
394+c, tdbSNP:201227875
414+a, gdbSNP:1803976
435+c, g, tdbSNP:139210892
436+c, gdbSNP:201956930
441+c, tdbSNP:200329745
450+c, tdbSNP:201417893
455+a, gdbSNP:35565661
456+a, gdbSNP:200824910
458..459+, cdbSNP:72306258
462+c, gdbSNP:201241742
468+c, tdbSNP:1050605
496+g, tdbSNP:199587874
497+c, tdbSNP:200721210
500+a, g, tdbSNP:36065127
508+c, tdbSNP:3191127
509+c, tdbSNP:200174784
510+a, gdbSNP:200716985
512+c, gdbSNP:201740473
520+a, tdbSNP:200078978
528+c, tdbSNP:200980127
531+c, tdbSNP:3191218
542+a, cdbSNP:201308167
555+a, cdbSNP:199989428
559+a, gdbSNP:201104479
561+a, tdbSNP:112102057
Gene SymbolMIF
Gene SynonymGIF; GLIF; MMIF
Chromosome22
Locus Map22q11.23
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002415 Homo sapiens macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mRNA. Full Length $162.69
ORF Sequence $159.00
Title Overexpression of macrophage migration inhibitory factor in adenoid cystic carcinoma: correlation with enhanced metastatic potential .
Author Liu,H., Chen,G., Zhang,W., Zhu,J.Y., Lin,Z.Q., Gong,Z.C., Wang,F.Q., Jia,J., Sun,Z.J. and Zhao,Y.F.
Journal J. Cancer Res. Clin. Oncol. 139 (2), 287-295 (2013)
Title Macrophage migration inhibitory factor deficiency is associated with impaired killing of gram-negative bacteria by macrophages and increased susceptibility to Klebsiella pneumoniae sepsis .
Author Roger,T., Delaloye,J., Chanson,A.L., Giddey,M., Le Roy,D. and Calandra,T.
Journal J. Infect. Dis. 207 (2), 331-339 (2013)
Title Expression of macrophage migration-inhibitory factor is correlated with progression in oral cavity carcinomas .
Author Kindt,N., Lechien,J., Decaestecker,C., Rodriguez,A., Chantrain,G., Remmelink,M., Laurent,G., Gabius,H.J. and Saussez,S.
Journal Anticancer Res. 32 (10), 4499-4505 (2012)
Title Molecular function of macrophage migration inhibitory factor and a novel therapy for inflammatory bowel disease .
Author Nishihira,J.
Journal Ann. N. Y. Acad. Sci. 1271, 53-57 (2012)
Title Identification of cellular proteins interacting with influenza A virus PB1-F2 protein .
Author Guan,Z.H., Zhang,M.L., Hou,P.L., Duan,M., Cui,Y.M. and Wang,X.R.
Journal Acta Virol. 56 (3), 199-207 (2012)
Title Genomic cloning of mouse MIF (macrophage inhibitory factor) and genetic mapping of the human and mouse expressed gene and nine mouse pseudogenes .
Author Kozak,C.A., Adamson,M.C., Buckler,C.E., Segovia,L., Paralkar,V. and Wistow,G.
Journal Genomics 27 (3), 405-411 (1995)
Title The major binding protein of the interferon antagonist sarcolectin in human placenta is a macrophage migration inhibitory factor .
Author Zeng,F.Y., Weiser,W.Y., Kratzin,H., Stahl,B., Karas,M. and Gabius,H.J.
Journal Arch. Biochem. Biophys. 303 (1), 74-80 (1993)
Title Human liver protein map: a reference database established by microsequencing and gel comparison .
Author Hochstrasser,D.F., Frutiger,S., Paquet,N., Bairoch,A., Ravier,F., Pasquali,C., Sanchez,J.C., Tissot,J.D., Bjellqvist,B., Vargas,R. et al.
Journal Electrophoresis 13 (12), 992-1001 (1992)
Title Molecular cloning of a cDNA encoding a human macrophage migration inhibitory factor .
Author Weiser,W.Y., Temple,P.A., Witek-Giannotti,J.S., Remold,H.G., Clark,S.C. and David,J.R.
Journal Proc. Natl. Acad. Sci. U.S.A. 86 (19), 7522-7526 (1989)
Title Glycolipid receptor for human migration inhibitory factor: fucose and sialic acid are important for the human monocyte response to migration inhibitory factor .
Author Liu,D.Y., Yu,S.F., Remold,H.G. and David,J.R.
Journal Cell. Immunol. 90 (2), 539-546 (1985)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878