Homo sapiens chemokine (C-X-C motif) ligand 9 (CXCL9), mRNA.
| RefSeq Version | NM_002416.1, 4505186 |
| Length | 2545 bp |
| Structure | linear |
| Update Date | 27-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens chemokine (C-X-C motif) ligand 9 (CXCL9), mRNA. |
| Product | C-X-C motif chemokine 9 precursor |
| Comment | Summary: The function of this gene has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines. [provided by RefSeq]. |
| RefSeq | NP_002407.1 |
| CDS | 40..417 | Exon (1) | 1..103 | Exon (2) | 1..103 | Exon (3) | 104..230 | Exon (4) | 231..315 | Exon (5) | 316..2545 |
| Translation | MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(168) | - | t, c | dbSNP:111816429 |
| complement(198) | - | g, a | dbSNP:79440907 |
| complement(390) | - | t, c | dbSNP:78048652 |
| complement(397) | - | t, g | dbSNP:114640872 |
| complement(412) | - | t, c | dbSNP:61750813 |
| complement(511) | - | g, c | dbSNP:115116604 |
| complement(597) | - | t, c | dbSNP:10031051 |
| complement(658) | - | c, a | dbSNP:116751816 |
| 760 | + | c, t | dbSNP:41490646 |
| complement(862) | - | g, a | dbSNP:116345824 |
| complement(884) | - | g, a | dbSNP:116073852 |
| complement(1046) | - | g, a | dbSNP:111956854 |
| 1170 | + | c, t | dbSNP:3733236 |
| complement(1685) | - | t, c | dbSNP:74454210 |
| 1822 | + | c, t | dbSNP:41484052 |
| 2001 | + | c, t | dbSNP:41462147 |
| 2016 | + | c, t | dbSNP:41527544 |
| 2121 | + | a, g | dbSNP:41469350 |
| 2180 | + | c, t | dbSNP:10336 |
| 2208 | + | c, t | dbSNP:41457447 |
| complement(2213) | - | t, c | dbSNP:112123906 |
| 2341 | + | a, g | dbSNP:34488931 |
| 2351 | + | c, t | dbSNP:35324603 |
| 2409 | + | c, t | dbSNP:10337 |
| 2419 | + | c, t | dbSNP:1050176 |
| 2525 | + | a, g | dbSNP:35934571 |
| Gene Symbol | CXCL9 |
| Gene Synonym | CMK; crg-10; Humig; MIG; SCYB9 |
| Chromosome | 4 |
| Locus Map | 4q21 |
| All Transcripts | NM_002416 |
| Title | CXCL9 induces chemotaxis, chemorepulsion and endothelial barrier disruption through CXCR3-mediated activation of melanoma cells . |
| Author | Amatschek,S., Lucas,R., Eger,A., Pflueger,M., Hundsberger,H., Knoll,C., Grosse-Kracht,S., Schuett,W., Koszik,F., Maurer,D. and Wiesner,C. |
| Journal | Br. J. Cancer 104 (3), 469-479 (2011) |
| Title | CXCL9 and CXCL11 chemokines modulation by peroxisome proliferator-activated receptor-alpha agonists secretion in Graves' and normal thyrocytes . |
| Author | Antonelli,A., Ferrari,S.M., Frascerra,S., Pupilli,C., Mancusi,C., Metelli,M.R., Orlando,C., Ferrannini,E. and Fallahi,P. |
| Journal | J. Clin. Endocrinol. Metab. 95 (12), E413-E420 (2010) |
| Title | Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility 'hot-spot' . |
| Author | Johnatty,S.E., Beesley,J., Chen,X., Macgregor,S., Duffy,D.L., Spurdle,A.B., deFazio,A., Gava,N., Webb,P.M., Rossing,M.A., Doherty,J.A., Goodman,M.T., Lurie,G., Thompson,P.J., Wilkens,L.R., Ness,R.B., Moysich,K.B., Chang-Claude,J., Wang-Gohrke,S., Cramer,D.W., Terry,K.L., Hankinson,S.E., Tworoger,S.S., Garcia-Closas,M., Yang,H., Lissowska,J., Chanock,S.J., Pharoah,P.D., Song,H., Whitemore,A.S., Pearce,C.L., Stram,D.O., Wu,A.H., Pike,M.C., Gayther,S.A., Ramus,S.J., Menon,U., Gentry-Maharaj,A., Anton-Culver,H., Ziogas,A., Hogdall,E., Kjaer,S.K., Hogdall,C., Berchuck,A., Schildkraut,J.M., Iversen,E.S., Moorman,P.G., Phelan,C.M., Sellers,T.A., Cunningham,J.M., Vierkant,R.A., Rider,D.N., Goode,E.L., Haviv,I. and Chenevix-Trench,G. |
| Journal | PLoS Genet. 6 (7), E1001016 (2010) |
| Title | Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls . |
| Author | Schuurhof,A., Bont,L., Siezen,C.L., Hodemaekers,H., van Houwelingen,H.C., Kimman,T.G., Hoebee,B., Kimpen,J.L. and Janssen,R. |
| Journal | Pediatr. Pulmonol. 45 (6), 608-613 (2010) |
| Title | MIG and the regulatory cytokines IL-10 and TGF-beta1 correlate with malaria vaccine immunogenicity and efficacy . |
| Author | Dunachie,S.J., Berthoud,T., Keating,S.M., Hill,A.V. and Fletcher,H.A. |
| Journal | PLoS ONE 5 (9), E12557 (2010) |
| Title | Localization of the gene for the human MIG cytokine on chromosome 4q21 adjacent to INP10 reveals a chemokine 'mini-cluster' . |
| Author | Lee,H.H. and Farber,J.M. |
| Journal | Cytogenet. Cell Genet. 74 (4), 255-258 (1996) |
| Title | Human Mig chemokine: biochemical and functional characterization . |
| Author | Liao,F., Rabin,R.L., Yannelli,J.R., Koniaris,L.G., Vanguri,P. and Farber,J.M. |
| Journal | J. Exp. Med. 182 (5), 1301-1314 (1995) |
| Title | HuMig: a new human member of the chemokine family of cytokines . |
| Author | Farber,J.M. |
| Journal | Biochem. Biophys. Res. Commun. 192 (1), 223-230 (1993) |
| Title | A macrophage mRNA selectively induced by gamma-interferon encodes a member of the platelet factor 4 family of cytokines . |
| Author | Farber,J.M. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 87 (14), 5238-5242 (1990) |
| Title | Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs . |
| Author | Itoh,H., Toyama,R., Kozasa,T., Tsukamoto,T., Matsuoka,M. and Kaziro,Y. |
| Journal | J. Biol. Chem. 263 (14), 6656-6664 (1988) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |