• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-X-C motif) ligand 9 (CXCL9), mRNA.


RefSeq Accession Definition Services Price Order
NM_002416 Homo sapiens chemokine (C-X-C motif) ligand 9 (CXCL9), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002416.1, 4505186
Length 2545 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-X-C motif) ligand 9 (CXCL9), mRNA.
Product C-X-C motif chemokine 9 precursor
Comment

Summary: The function of this gene has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines. [provided by RefSeq, Jul 2008].

RefSeq NP_002407.1
CDS 40..417
Misc Feature(1)109..111
Misc Feature(2)121..297
Misc Feature(3)order(121..129,145..147,160..177,202..210,238..243,
Misc Feature(4)121..129
Misc Feature(5)order(124..126,133..135,175..180,187..195,223..234,
Misc Feature(6)order(124..126,133..135,187..189,193..195,223..225,
Misc Feature(7)order(127..132,136..138)
Misc Feature(8)order(133..153,160..177)
Misc Feature(9)order(139..144,148..150,160..162,172..174,229..231,
Misc Feature(10)order(163..165,169..171,271..273,280..282,286..297)
Misc Feature(11)order(169..171,178..180,235..237,241..243,250..255)
Misc Feature(12)order(175..180,190..192,226..228,232..234,262..264,
Misc Feature(13)202..210
Misc Feature(14)202..210
Misc Feature(15)241..249
Exon (1)1..103
Gene:CXCL9
Gene Synonym:CMK; crg-10; Humig; MIG; SCYB9
Exon (2)104..230
Gene:CXCL9
Gene Synonym:CMK; crg-10; Humig; MIG; SCYB9
Exon (3)231..315
Gene:CXCL9
Gene Synonym:CMK; crg-10; Humig; MIG; SCYB9
Exon (4)316..2545
Gene:CXCL9
Gene Synonym:CMK; crg-10; Humig; MIG; SCYB9
Translation MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR QKKTT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(111)-dbSNP:
complement(111)-t, gdbSNP:140548865
complement(158)-g, cdbSNP:145442311
complement(168)-t, cdbSNP:111816429
complement(198)-g, adbSNP:79440907
complement(228)-t, gdbSNP:143141978
complement(380)-dbSNP:
complement(380)-t, cdbSNP:139830877
complement(390)-t, cdbSNP:78048652
complement(412)-t, cdbSNP:61750813
complement(414)-t, cdbSNP:138184008
complement(511)-g, cdbSNP:115116604
complement(524)-t, adbSNP:192154610
complement(593)-t, cdbSNP:146434302
complement(597)-t, cdbSNP:10031051
complement(658)-c, adbSNP:116751816
complement(760)-t, cdbSNP:41490646
complement(785)-c, adbSNP:189193108
complement(862)-g, adbSNP:116345824
complement(884)-g, adbSNP:185541502
complement(966)-t, gdbSNP:193117940
complement(1034)-t, cdbSNP:143824398
complement(1046)-g, adbSNP:111956854
complement(1083)-c, adbSNP:187688326
complement(1131)-t, cdbSNP:182603102
complement(1170)-t, cdbSNP:3733236
complement(1325)-g, adbSNP:143711436
complement(1685)-t, cdbSNP:74454210
complement(1700)-g, adbSNP:148944642
complement(1822)-t, cdbSNP:41484052
complement(1954)-g, cdbSNP:191438271
complement(2001)-t, cdbSNP:41462147
complement(2016)-t, cdbSNP:41527544
complement(2121)-g, adbSNP:41469350
complement(2152)-g, cdbSNP:190434490
complement(2180)-t, cdbSNP:10336
complement(2208)-t, cdbSNP:41457447
complement(2213)-t, cdbSNP:112123906
complement(2240)-t, gdbSNP:145094605
complement(2328)-g, adbSNP:183941374
complement(2341)-g, adbSNP:34488931
complement(2351)-t, cdbSNP:35324603
complement(2409)-t, cdbSNP:10337
complement(2419)-t, cdbSNP:1050176
complement(2525)-g, adbSNP:35934571
Gene SymbolCXCL9
Gene SynonymCMK; crg-10; Humig; MIG; SCYB9
Chromosome4
Locus Map4q21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002416 Homo sapiens chemokine (C-X-C motif) ligand 9 (CXCL9), mRNA. Full Length $738.05
ORF Sequence $159.00
Title Bortezomib regulates the chemotactic characteristics of T cells through downregulation of CXCR3/CXCL9 expression and induction of apoptosis .
Author Liu,W., Ren,H.Y., Dong,Y.J., Wang,L.H., Yin,Y., Li,Y., Qiu,Z.X., Cen,X.N. and Shi,Y.J.
Journal Int. J. Hematol. 96 (6), 764-772 (2012)
Title Intragraft transcriptome level of CXCL9 as biomarker of acute cellular rejection after liver transplantation .
Author Asaoka,T., Marubashi,S., Kobayashi,S., Hama,N., Eguchi,H., Takeda,Y., Tanemura,M., Wada,H., Takemasa,I., Takahashi,H., Ruiz,P., Doki,Y., Mori,M. and Nagano,H.
Journal J. Surg. Res. 178 (2), 1003-1014 (2012)
Title Chemokine-mediated tissue recruitment of CXCR3+ CD4+ T cells plays a major role in the pathogenesis of chronic GVHD .
Author Croudace,J.E., Inman,C.F., Abbotts,B.E., Nagra,S., Nunnick,J., Mahendra,P., Craddock,C., Malladi,R. and Moss,P.A.
Journal Blood 120 (20), 4246-4255 (2012)
Title Myocardial chemokine expression and intensity of myocarditis in Chagas cardiomyopathy are controlled by polymorphisms in CXCL9 and CXCL10 .
Author Nogueira,L.G., Santos,R.H., Ianni,B.M., Fiorelli,A.I., Mairena,E.C., Benvenuti,L.A., Frade,A., Donadi,E., Dias,F., Saba,B., Wang,H.T., Fragata,A., Sampaio,M., Hirata,M.H., Buck,P., Mady,C., Bocchi,E.A., Stolf,N.A., Kalil,J. and Cunha-Neto,E.
Journal PLoS Negl Trop Dis 6 (10), E1867 (2012)
Title Gene profile of chemokines on hepatic stellate cells of schistosome-infected mice and antifibrotic roles of CXCL9/10 on liver non-parenchymal cells .
Author Liang,Y.J., Luo,J., Lu,Q., Zhou,Y., Wu,H.W., Zheng,D., Ren,Y.Y., Sun,K.Y., Wang,Y. and Zhang,Z.S.
Journal PLoS ONE 7 (8), E42490 (2012)
Title Localization of the gene for the human MIG cytokine on chromosome 4q21 adjacent to INP10 reveals a chemokine 'mini-cluster' .
Author Lee,H.H. and Farber,J.M.
Journal Cytogenet. Cell Genet. 74 (4), 255-258 (1996)
Title Human Mig chemokine: biochemical and functional characterization .
Author Liao,F., Rabin,R.L., Yannelli,J.R., Koniaris,L.G., Vanguri,P. and Farber,J.M.
Journal J. Exp. Med. 182 (5), 1301-1314 (1995)
Title HuMig: a new human member of the chemokine family of cytokines .
Author Farber,J.M.
Journal Biochem. Biophys. Res. Commun. 192 (1), 223-230 (1993)
Title A macrophage mRNA selectively induced by gamma-interferon encodes a member of the platelet factor 4 family of cytokines .
Author Farber,J.M.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (14), 5238-5242 (1990)
Title Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs .
Author Itoh,H., Toyama,R., Kozasa,T., Tsukamoto,T., Matsuoka,M. and Kaziro,Y.
Journal J. Biol. Chem. 263 (14), 6656-6664 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878