• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-X-C motif) ligand 9 (CXCL9), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu26807 Homo sapiens chemokine (C-X-C motif) ligand 9 (CXCL9), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu26807C Homo sapiens chemokine (C-X-C motif) ligand 9 (CXCL9), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002416.1, 4505186
Length 378 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-X-C motif) ligand 9 (CXCL9), mRNA.
Product C-X-C motif chemokine 9 precursor
Comment

Summary: The function of this gene has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines. [provided by RefSeq, Jul 2008].

RefSeq NP_002407.1
CDS 40..417
Misc Feature(1)109..111
Misc Feature(2)121..309
Misc Feature(3)order(121..129,145..147,160..177,202..210,238..243,
Misc Feature(4)121..129
Misc Feature(5)order(124..126,133..135,175..180,187..195,223..234,
Misc Feature(6)order(124..126,133..135,187..189,193..195,223..225,
Misc Feature(7)order(127..132,136..138)
Misc Feature(8)order(133..153,160..177)
Misc Feature(9)order(139..144,148..150,160..162,172..174,229..231,
Misc Feature(10)order(163..165,169..171,271..273,280..282,286..297,
Misc Feature(11)order(169..171,178..180,235..237,241..243,250..255)
Misc Feature(12)order(175..180,190..192,226..228,232..234,262..264,
Misc Feature(13)202..210
Misc Feature(14)202..210
Misc Feature(15)241..249
Exon (1)1..103
Gene:CXCL9
Gene Synonym:CMK; crg-10; Humig; MIG; SCYB9
Exon (2)104..230
Gene:CXCL9
Gene Synonym:CMK; crg-10; Humig; MIG; SCYB9
Exon (3)231..315
Gene:CXCL9
Gene Synonym:CMK; crg-10; Humig; MIG; SCYB9
Exon (4)316..2545
Gene:CXCL9
Gene Synonym:CMK; crg-10; Humig; MIG; SCYB9
Translation MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR QKKTT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(111)-dbSNP:
complement(111)-t, gdbSNP:140548865
complement(138)-g, adbSNP:377485242
complement(154)-t, cdbSNP:375701976
complement(158)-g, cdbSNP:145442311
complement(168)-t, cdbSNP:111816429
complement(173)-g, adbSNP:370953150
complement(198)-g, adbSNP:79440907
complement(228)-t, gdbSNP:143141978
complement(380)-dbSNP:
complement(380)-t, cdbSNP:139830877
complement(390)-t, cdbSNP:78048652
complement(412)-t, cdbSNP:61750813
complement(414)-t, cdbSNP:138184008
complement(465)-t, cdbSNP:374288711
complement(511)-g, cdbSNP:115116604
complement(524)-t, adbSNP:192154610
complement(593)-t, cdbSNP:146434302
complement(597)-t, cdbSNP:10031051
complement(597)-t, cdbSNP:386509005
complement(643)-t, gdbSNP:373509194
complement(658)-c, adbSNP:116751816
complement(668..669)-tg, cadbSNP:386676191
complement(760)-t, cdbSNP:41490646
complement(785)-c, adbSNP:189193108
complement(862)-g, adbSNP:116345824
complement(884)-g, adbSNP:185541502
complement(966)-t, gdbSNP:193117940
complement(1034)-t, cdbSNP:143824398
complement(1046)-g, adbSNP:111956854
complement(1083)-c, adbSNP:187688326
complement(1131)-t, cdbSNP:182603102
complement(1170)-t, cdbSNP:3733236
complement(1202)-t, cdbSNP:369577234
complement(1325)-g, adbSNP:143711436
complement(1365)-c, adbSNP:369441150
complement(1685)-t, cdbSNP:74454210
complement(1700)-g, adbSNP:148944642
1822+c, tdbSNP:41484052
complement(1954)-g, cdbSNP:191438271
2001+c, tdbSNP:41462147
2016+c, tdbSNP:41527544
complement(2081)-g, adbSNP:372283651
2121+a, gdbSNP:41469350
complement(2131)-t, cdbSNP:377181515
complement(2152)-g, cdbSNP:190434490
complement(2180)-t, cdbSNP:386512244
2180+c, tdbSNP:10336
complement(2208)-t, cdbSNP:41457447
complement(2212)-g, adbSNP:371926690
complement(2213)-t, cdbSNP:112123906
complement(2240)-t, gdbSNP:145094605
complement(2328)-g, adbSNP:183941374
2341+a, gdbSNP:34488931
2351+c, tdbSNP:35324603
complement(2409)-t, cdbSNP:386484855
2409+c, tdbSNP:10337
complement(2419)-t, cdbSNP:1050176
complement(2485..2486)-, tttcaaattadbSNP:368071695
2525+a, gdbSNP:35934571
Gene SymbolCXCL9
Gene SynonymCMK; crg-10; Humig; MIG; SCYB9
Chromosome4
Locus Map4q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002416 Homo sapiens chemokine (C-X-C motif) ligand 9 (CXCL9), mRNA. On-demand $159.00 7-9
Title IP-10/CXCL10 and MIG/CXCL9 as novel markers for the diagnosis of lymphoma-associated hemophagocytic syndrome .
Author Maruoka H, Inoue D, Takiuchi Y, Nagano S, Arima H, Tabata S, Matsushita A, Ishikawa T, Oita T and Takahashi T.
Journal Ann. Hematol. 93 (3), 393-401 (2014)
Title Plasma CXCL9 elevations correlate with chronic GVHD diagnosis .
Author Kitko CL, Levine JE, Storer BE, Chai X, Fox DA, Braun TM, Couriel DR, Martin PJ, Flowers ME, Hansen JA, Chang L, Conlon M, Fiema BJ, Morgan R, Pongtornpipat P, Lamiman K, Ferrara JL, Lee SJ and Paczesny S.
Journal Blood 123 (5), 786-793 (2014)
Title CXC chemokines CXCL1, CXCL9, CXCL10 and CXCL12 are variably expressed in patients with sickle cell disease and carriers: are they predictive tools for disease complications? .
Author Ostadebrahimi H, Jamali Z, Nazari M, Bahri M, Farahmandnia Z, Khandany BK, Taheri M, Khorramdelazad H, Hakimizadeh E, Zaker F, Rezaeian M and Hassanshahi G.
Journal Clin. Lab. 60 (1), 99-104 (2014)
Title CXCR3 ligands are associated with the continuum of diffuse alveolar damage to chronic lung allograft dysfunction .
Author Shino MY, Weigt SS, Li N, Palchevskiy V, Derhovanessian A, Saggar R, Sayah DM, Gregson AL, Fishbein MC, Ardehali A, Ross DJ, Lynch JP 3rd, Elashoff RM and Belperio JA.
Journal Am. J. Respir. Crit. Care Med. 188 (9), 1117-1125 (2013)
Title CXCL9 associated with sustained virological response in chronic hepatitis B patients receiving peginterferon alfa-2a therapy: a pilot study .
Author Lee IC, Huang YH, Su CW, Wang YJ, Huo TI, Lee KC and Lin HC.
Journal PLoS ONE 8 (10), E76798 (2013)
Title Localization of the gene for the human MIG cytokine on chromosome 4q21 adjacent to INP10 reveals a chemokine 'mini-cluster' .
Author Lee HH and Farber JM.
Journal Cytogenet. Cell Genet. 74 (4), 255-258 (1996)
Title Human Mig chemokine: biochemical and functional characterization .
Author Liao F, Rabin RL, Yannelli JR, Koniaris LG, Vanguri P and Farber JM.
Journal J. Exp. Med. 182 (5), 1301-1314 (1995)
Title HuMig: a new human member of the chemokine family of cytokines .
Author Farber JM.
Journal Biochem. Biophys. Res. Commun. 192 (1), 223-230 (1993)
Title A macrophage mRNA selectively induced by gamma-interferon encodes a member of the platelet factor 4 family of cytokines .
Author Farber JM.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (14), 5238-5242 (1990)
Title Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs .
Author Itoh H, Toyama R, Kozasa T, Tsukamoto T, Matsuoka M and Kaziro Y.
Journal J. Biol. Chem. 263 (14), 6656-6664 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.