• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens matrix metallopeptidase 13 (collagenase 3) (MMP13), mRNA.


RefSeq Accession Definition Services Price Order
NM_002427 Homo sapiens matrix metallopeptidase 13 (collagenase 3) (MMP13), mRNA. ORF Sequence $410.64
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002427.3, 296010793
Length 2735 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens matrix metallopeptidase 13 (collagenase 3) (MMP13), mRNA.
Product collagenase 3 preproprotein
Comment

Summary: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq, Jul 2008].

RefSeq NP_002418.1
CDS 30..1445
Misc Feature(1)138..302
Misc Feature(2)189..191
Misc Feature(3)309..332
Misc Feature(4)336..338
Misc Feature(5)363..830
Misc Feature(6)order(519..521,555..557,576..596,621..623,693..698,
Misc Feature(7)order(693..698,705..707,723..725)
Misc Feature(8)870..1442
Misc Feature(9)order(900..902,906..908,1032..1034,1038..1040,1176..1178,
Exon (1)1..149
Gene:MMP13
Gene Synonym:CLG3; MANDP1
Exon (2)150..391
Gene:MMP13
Gene Synonym:CLG3; MANDP1
Exon (3)392..540
Gene:MMP13
Gene Synonym:CLG3; MANDP1
Exon (4)541..666
Gene:MMP13
Gene Synonym:CLG3; MANDP1
Exon (5)667..828
Gene:MMP13
Gene Synonym:CLG3; MANDP1
Exon (6)829..946
Gene:MMP13
Gene Synonym:CLG3; MANDP1
Exon (7)947..1080
Gene:MMP13
Gene Synonym:CLG3; MANDP1
Exon (8)1081..1240
Gene:MMP13
Gene Synonym:CLG3; MANDP1
Exon (9)1241..1344
Gene:MMP13
Gene Synonym:CLG3; MANDP1
Exon (10)1345..2719
Gene:MMP13
Gene Synonym:CLG3; MANDP1
Translation MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(4)-t, adbSNP:56263074
complement(30)-t, cdbSNP:143446525
complement(34)-t, adbSNP:554797
complement(52)-t, cdbSNP:2276093
complement(81)-g, adbSNP:61733406
complement(85)-g, adbSNP:143427641
complement(97)-g, adbSNP:148856037
complement(100)-c, adbSNP:138415943
complement(114)-g, cdbSNP:150142500
complement(153)-dbSNP:
complement(153)-g, adbSNP:112742775
complement(164)-g, adbSNP:17860524
complement(167)-g, adbSNP:200537937
complement(208)-g, adbSNP:183292652
complement(219)-t, gdbSNP:111947721
complement(240)-t, gdbSNP:146526422
complement(250)-t, cdbSNP:121909498
complement(253)-t, cdbSNP:121909497
complement(254)-g, adbSNP:145545704
complement(255)-c, adbSNP:140377670
complement(277)-g, adbSNP:201603479
complement(294)-g, cdbSNP:12295719
complement(301)-t, cdbSNP:121909499
complement(327)-t, cdbSNP:148152034
complement(330)-c, adbSNP:151254531
complement(355)-c, adbSNP:189974040
complement(467)-dbSNP:
complement(467)-t, cdbSNP:17860530
complement(494)-t, gdbSNP:143292324
complement(501)-t, cdbSNP:181426884
complement(524)-g, cdbSNP:148746302
complement(538)-t, gdbSNP:145243532
complement(541)-dbSNP:
complement(541)-t, cdbSNP:202231908
complement(548)-g, adbSNP:189379640
complement(622)-t, adbSNP:150048151
complement(648)-c, adbSNP:140059558
complement(691)-dbSNP:
complement(691)-g, adbSNP:147544761
complement(692)-t, cdbSNP:143331971
complement(723)-c, adbSNP:121909500
complement(799)-t, adbSNP:140993310
complement(800)-g, adbSNP:150719050
complement(813)-t, adbSNP:202123339
complement(824)-g, cdbSNP:141127894
complement(871)-dbSNP:
complement(871)-g, adbSNP:148230434
complement(885)-t, gdbSNP:149330684
complement(944)-g, adbSNP:199680440
complement(964)-dbSNP:
complement(964)-t, cdbSNP:142601143
complement(982)-g, adbSNP:199992289
complement(997)-g, adbSNP:185832993
complement(1096)-dbSNP:
complement(1096)-t, gdbSNP:201397692
complement(1104)-c, adbSNP:200148057
complement(1109)-g, adbSNP:61737008
complement(1111)-t, cdbSNP:145425594
complement(1146)-t, gdbSNP:112373498
complement(1198)-g, adbSNP:17860568
complement(1243)-dbSNP:
complement(1243)-t, cdbSNP:190896822
complement(1280)-t, cdbSNP:150203792
complement(1303..1304)-, gdbSNP:36086947
complement(1309)-t, cdbSNP:34546980
complement(1364)-dbSNP:
complement(1364)-g, adbSNP:145432284
complement(1365)-t, cdbSNP:139939501
complement(1401)-g, adbSNP:142064825
complement(1406)-c, adbSNP:144776439
complement(1446)-t, cdbSNP:141028591
complement(1510)-t, cdbSNP:186374727
complement(1605)-g, adbSNP:17860583
complement(1731)-t, cdbSNP:112821768
complement(1759)-t, cdbSNP:17860584
complement(1871)-t, cdbSNP:182315436
complement(2073)-t, cdbSNP:114428333
complement(2245)-t, adbSNP:189328192
complement(2330)-g, adbSNP:1042840
complement(2441..2442)-, tdbSNP:71066124
complement(2442..2443)-, adbSNP:35477433
complement(2493)-t, adbSNP:137968508
complement(2509)-c, adbSNP:17860586
complement(2521)-g, adbSNP:146954198
complement(2582)-g, adbSNP:184451705
complement(2583)-t, cdbSNP:113572120
complement(2586)-t, g, cdbSNP:17860587
complement(2645)-t, cdbSNP:181285292
complement(2664)-t, gdbSNP:188511209
complement(2666)-g, adbSNP:184593720
Gene SymbolMMP13
Gene SynonymCLG3; MANDP1
Chromosome11
Locus Map11q22.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002427 Homo sapiens matrix metallopeptidase 13 (collagenase 3) (MMP13), mRNA. Full Length $793.15
ORF Sequence $410.64
Title Matrix metalloproteinase-13 (MMP-13) directly and indirectly promotes tumor angiogenesis .
Author Kudo,Y., Iizuka,S., Yoshida,M., Tsunematsu,T., Kondo,T., Subarnbhesaj,A., Deraz,E.M., Siriwardena,S.B., Tahara,H., Ishimaru,N., Ogawa,I. and Takata,T.
Journal J. Biol. Chem. 287 (46), 38716-38728 (2012)
Title Osterix regulates calcification and degradation of chondrogenic matrices through matrix metalloproteinase 13 (MMP13) expression in association with transcription factor Runx2 during endochondral ossification .
Author Nishimura,R., Wakabayashi,M., Hata,K., Matsubara,T., Honma,S., Wakisaka,S., Kiyonari,H., Shioi,G., Yamaguchi,A., Tsumaki,N., Akiyama,H. and Yoneda,T.
Journal J. Biol. Chem. 287 (40), 33179-33190 (2012)
Title MicroRNA-125b down-regulates matrix metallopeptidase 13 and inhibits cutaneous squamous cell carcinoma cell proliferation, migration, and invasion .
Author Xu,N., Zhang,L., Meisgen,F., Harada,M., Heilborn,J., Homey,B., Grander,D., Stahle,M., Sonkoly,E. and Pivarcsi,A.
Journal J. Biol. Chem. 287 (35), 29899-29908 (2012)
Title Matrix metalloproteinase 13 genotype in rs640198 polymorphism is associated with severe coronary artery disease .
Author Vasku,A., Meluzin,J., Blahak,J., Kincl,V., Goldbergova,M.P., Sitar,J., Zlamal,F., Bienertova-Vasku,J. and Vitovec,J.
Journal Dis. Markers 33 (1), 43-49 (2012)
Title MMP13 polymorphism decreases risk for dental caries .
Author Tannure,P.N., Kuchler,E.C., Falagan-Lotsch,P., Amorim,L.M., Raggio Luiz,R., Costa,M.C., Vieira,A.R. and Granjeiro,J.M.
Journal Caries Res. 46 (4), 401-407 (2012)
Title The helping hand of collagenase-3 (MMP-13): 2.7 A crystal structure of its C-terminal haemopexin-like domain .
Author Gomis-Ruth,F.X., Gohlke,U., Betz,M., Knauper,V., Murphy,G., Lopez-Otin,C. and Bode,W.
Journal J. Mol. Biol. 264 (3), 556-566 (1996)
Title Cellular mechanisms for human procollagenase-3 (MMP-13) activation. Evidence that MT1-MMP (MMP-14) and gelatinase a (MMP-2) are able to generate active enzyme .
Author Knauper,V., Will,H., Lopez-Otin,C., Smith,B., Atkinson,S.J., Stanton,H., Hembry,R.M. and Murphy,G.
Journal J. Biol. Chem. 271 (29), 17124-17131 (1996)
Title Cloning, expression, and type II collagenolytic activity of matrix metalloproteinase-13 from human osteoarthritic cartilage .
Author Mitchell,P.G., Magna,H.A., Reeves,L.M., Lopresti-Morrow,L.L., Yocum,S.A., Rosner,P.J., Geoghegan,K.F. and Hambor,J.E.
Journal J. Clin. Invest. 97 (3), 761-768 (1996)
Title The human collagenase-3 (CLG3) gene is located on chromosome 11q22.3 clustered to other members of the matrix metalloproteinase gene family .
Author Pendas,A.M., Matilla,T., Estivill,X. and Lopez-Otin,C.
Journal Genomics 26 (3), 615-618 (1995)
Title Molecular cloning and expression of collagenase-3, a novel human matrix metalloproteinase produced by breast carcinomas .
Author Freije,J.M., Diez-Itza,I., Balbin,M., Sanchez,L.M., Blasco,R., Tolivia,J. and Lopez-Otin,C.
Journal J. Biol. Chem. 269 (24), 16766-16773 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878