• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens matrix metallopeptidase 13 (collagenase 3) (MMP13), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19625 Homo sapiens matrix metallopeptidase 13 (collagenase 3) (MMP13), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu19625C Homo sapiens matrix metallopeptidase 13 (collagenase 3) (MMP13), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002427.3, 296010793
Length 1416 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens matrix metallopeptidase 13 (collagenase 3) (MMP13), mRNA.
Product collagenase 3 preproprotein
Comment

Summary: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq, Jul 2008].

RefSeq NP_002418.1
CDS 30..1445
Misc Feature(1)123..302
Misc Feature(2)189..191
Misc Feature(3)309..332
Misc Feature(4)336..338
Misc Feature(5)363..830
Misc Feature(6)363..830
Misc Feature(7)order(519..521,555..557,576..596,621..623,693..698,
Misc Feature(8)order(693..698,705..707,723..725)
Misc Feature(9)870..1442
Misc Feature(10)870..1019
Misc Feature(11)order(900..902,906..908,1032..1034,1038..1040,1176..1178,
Misc Feature(12)1020..1160
Misc Feature(13)1164..1310
Misc Feature(14)1311..1442
Exon (1)1..149
Gene:MMP13
Gene Synonym:CLG3; MANDP1; MMP-13
Exon (2)150..391
Gene:MMP13
Gene Synonym:CLG3; MANDP1; MMP-13
Exon (3)392..540
Gene:MMP13
Gene Synonym:CLG3; MANDP1; MMP-13
Exon (4)541..666
Gene:MMP13
Gene Synonym:CLG3; MANDP1; MMP-13
Exon (5)667..828
Gene:MMP13
Gene Synonym:CLG3; MANDP1; MMP-13
Exon (6)829..946
Gene:MMP13
Gene Synonym:CLG3; MANDP1; MMP-13
Exon (7)947..1080
Gene:MMP13
Gene Synonym:CLG3; MANDP1; MMP-13
Exon (8)1081..1240
Gene:MMP13
Gene Synonym:CLG3; MANDP1; MMP-13
Exon (9)1241..1344
Gene:MMP13
Gene Synonym:CLG3; MANDP1; MMP-13
Exon (10)1345..2719
Gene:MMP13
Gene Synonym:CLG3; MANDP1; MMP-13
Translation MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(4)-t, adbSNP:56263074
complement(30)-t, cdbSNP:143446525
34+a, tdbSNP:554797
52+c, tdbSNP:2276093
complement(81)-g, adbSNP:61733406
complement(85)-g, adbSNP:143427641
complement(97)-g, adbSNP:148856037
complement(100)-c, adbSNP:138415943
complement(114)-g, cdbSNP:150142500
complement(120)-g, adbSNP:369622822
complement(147)-t, cdbSNP:369436172
complement(153)-dbSNP:
complement(153)-g, adbSNP:112742775
complement(164)-g, adbSNP:17860524
complement(164)-g, adbSNP:386544866
complement(167)-g, adbSNP:200537937
complement(208)-g, adbSNP:183292652
complement(219)-t, gdbSNP:111947721
complement(240)-t, gdbSNP:146526422
250+c, tdbSNP:121909498
253+c, tdbSNP:121909497
complement(254)-g, adbSNP:145545704
complement(269)-g, adbSNP:376105726
complement(273)-t, gdbSNP:371513455
complement(277)-g, adbSNP:201603479
complement(294)-g, cdbSNP:12295719
301+c, tdbSNP:121909499
complement(327)-t, cdbSNP:148152034
complement(330)-c, adbSNP:151254531
complement(354)-g, adbSNP:369083541
complement(355)-t, c, adbSNP:189974040
complement(467)-dbSNP:
complement(467)-t, cdbSNP:386544867
467+c, tdbSNP:17860530
complement(468)-t, cdbSNP:368343121
complement(472)-t, adbSNP:374419716
complement(477)-g, cdbSNP:371894268
complement(494)-t, gdbSNP:143292324
complement(500)-g, adbSNP:368161332
complement(501)-t, cdbSNP:181426884
complement(524)-g, cdbSNP:148746302
complement(538)-t, gdbSNP:145243532
complement(541)-dbSNP:
complement(541)-t, cdbSNP:202231908
complement(548)-g, adbSNP:189379640
complement(557)-g, adbSNP:376889562
complement(622)-t, adbSNP:150048151
complement(648)-c, adbSNP:140059558
complement(691)-dbSNP:
complement(691)-g, adbSNP:147544761
complement(692)-t, cdbSNP:143331971
complement(707)-g, adbSNP:369960644
723+a, cdbSNP:121909500
complement(761)-g, adbSNP:375374606
complement(785)-g, adbSNP:372000933
complement(799)-t, adbSNP:140993310
complement(800)-g, adbSNP:150719050
complement(813)-t, adbSNP:202123339
complement(824)-g, cdbSNP:141127894
complement(832)-dbSNP:
complement(832)-t, gdbSNP:368628653
complement(833)-t, cdbSNP:376033599
complement(863)-t, cdbSNP:370869245
complement(871)-g, adbSNP:148230434
complement(885)-t, gdbSNP:149330684
complement(944)-g, adbSNP:199680440
complement(959)-dbSNP:
complement(959)-g, adbSNP:371762358
complement(964)-t, cdbSNP:142601143
complement(980)-c, adbSNP:367612153
complement(982)-g, adbSNP:199992289
complement(997)-g, adbSNP:185832993
complement(1089)-dbSNP:
complement(1089)-g, adbSNP:370996115
complement(1095)-t, cdbSNP:372747673
complement(1096)-t, gdbSNP:201397692
complement(1104)-c, adbSNP:200148057
complement(1109)-g, adbSNP:61737008
complement(1111)-t, cdbSNP:145425594
complement(1146)-t, gdbSNP:112373498
complement(1198)-g, adbSNP:17860568
complement(1202)-t, cdbSNP:370186829
complement(1240)-t, cdbSNP:375595761
complement(1243)-dbSNP:
complement(1243)-t, cdbSNP:190896822
complement(1280)-t, cdbSNP:150203792
complement(1303..1304)-, gdbSNP:36086947
1309+c, tdbSNP:34546980
complement(1327)-g, adbSNP:375834936
complement(1364)-dbSNP:
complement(1364)-g, adbSNP:145432284
complement(1365)-t, cdbSNP:139939501
complement(1368)-g, adbSNP:368928667
complement(1401)-g, adbSNP:142064825
complement(1406)-c, adbSNP:144776439
complement(1412)-g, adbSNP:374512736
complement(1446)-t, cdbSNP:141028591
complement(1458)-t, adbSNP:372513971
complement(1510)-t, cdbSNP:186374727
complement(1605)-t, cdbSNP:386544868
complement(1605)-g, adbSNP:17860583
complement(1731)-t, cdbSNP:112821768
complement(1759)-t, cdbSNP:17860584
complement(1841)-t, gdbSNP:377201387
complement(1871)-t, cdbSNP:182315436
complement(2014)-t, gdbSNP:373064452
complement(2073)-t, cdbSNP:114428333
complement(2245)-t, adbSNP:189328192
2330+a, gdbSNP:1042840
complement(2442..2443)-, adbSNP:35477433
complement(2493)-t, adbSNP:137968508
2509+a, cdbSNP:17860586
complement(2509)-t, gdbSNP:386544869
complement(2521)-g, adbSNP:146954198
complement(2582)-g, adbSNP:184451705
complement(2583)-t, cdbSNP:113572120
complement(2586)-t, g, cdbSNP:17860587
complement(2645)-t, cdbSNP:181285292
complement(2664)-t, gdbSNP:188511209
complement(2666)-g, adbSNP:184593720
Gene SymbolMMP13
Gene SynonymCLG3; MANDP1; MMP-13
Chromosome11
Locus Map11q22.3
Title MiR-126-5p regulates osteoclast differentiation and bone resorption in giant cell tumor through inhibition of MMP-13 .
Author Wu Z, Yin H, Liu T, Yan W, Li Z, Chen J, Chen H, Wang T, Jiang Z, Zhou W and Xiao J.
Journal Biochem. Biophys. Res. Commun. 443 (3), 944-949 (2014)
Title Crystal structure of full-length human collagenase 3 (MMP-13) with peptides in the active site defines exosites in the catalytic domain .
Author Stura EA, Visse R, Cuniasse P, Dive V and Nagase H.
Journal FASEB J. 27 (11), 4395-4405 (2013)
Title Pivotal role of matrix metalloproteinase 13 in extracellular matrix turnover in idiopathic pulmonary fibrosis .
Author Nkyimbeng T, Ruppert C, Shiomi T, Dahal B, Lang G, Seeger W, Okada Y, D'Armiento J and Gunther A.
Journal PLoS ONE 8 (9), E73279 (2013)
Title Gene polymorphism of matrix metalloproteinase-12 and -13 and association with colorectal cancer in Swedish patients .
Author VAN Nguyen S, Skarstedt M, Lofgren S, Zar N, Andersson RE, Lindh M, Matussek A and Dimberg J.
Journal Anticancer Res. 33 (8), 3247-3250 (2013)
Title SUMO-specific protease 2 suppresses cell migration and invasion through inhibiting the expression of MMP13 in bladder cancer cells .
Author Tan MY, Mu XY, Liu B, Wang Y, Bao ED, Qiu JX and Fan Y.
Journal Cell. Physiol. Biochem. 32 (3), 542-548 (2013)
Title Cellular mechanisms for human procollagenase-3 (MMP-13) activation. Evidence that MT1-MMP (MMP-14) and gelatinase a (MMP-2) are able to generate active enzyme .
Author Knauper V, Will H, Lopez-Otin C, Smith B, Atkinson SJ, Stanton H, Hembry RM and Murphy G.
Journal J. Biol. Chem. 271 (29), 17124-17131 (1996)
Title Cloning, expression, and type II collagenolytic activity of matrix metalloproteinase-13 from human osteoarthritic cartilage .
Author Mitchell PG, Magna HA, Reeves LM, Lopresti-Morrow LL, Yocum SA, Rosner PJ, Geoghegan KF and Hambor JE.
Journal J. Clin. Invest. 97 (3), 761-768 (1996)
Title Biochemical characterization of human collagenase-3 .
Author Knauper V, Lopez-Otin C, Smith B, Knight G and Murphy G.
Journal J. Biol. Chem. 271 (3), 1544-1550 (1996)
Title The human collagenase-3 (CLG3) gene is located on chromosome 11q22.3 clustered to other members of the matrix metalloproteinase gene family .
Author Pendas AM, Matilla T, Estivill X and Lopez-Otin C.
Journal Genomics 26 (3), 615-618 (1995)
Title Molecular cloning and expression of collagenase-3, a novel human matrix metalloproteinase produced by breast carcinomas .
Author Freije JM, Diez-Itza I, Balbin M, Sanchez LM, Blasco R, Tolivia J and Lopez-Otin C.
Journal J. Biol. Chem. 269 (24), 16766-16773 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.