Homo sapiens macrophage stimulating 1 receptor (c-met-related tyrosine kinase) (MST1R), mRNA.
| RefSeq Version | NM_002447.2, 153946392 |
| Length | 4785 bp |
| Structure | linear |
| Update Date | 24-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens macrophage stimulating 1 receptor (c-met-related tyrosine kinase) (MST1R), mRNA. |
| Product | macrophage-stimulating protein receptor precursor |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BP288515.1, X70040.1, AC105935.2 and CA503122.1. On Jul 26, 2007 this sequence version replaced gi:4505264. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data. |
| RefSeq | NP_002438.2 |
| CDS | 265..4467 | Exon (1) | 1..1494 | Exon (2) | 1..1494 | Exon (3) | 1495..1683 | Exon (4) | 1684..1812 | Exon (5) | 1813..1983 | Exon (6) | 1984..2144 | Exon (7) | 2145..2310 | Exon (8) | 2311..2447 | Exon (9) | 2448..2609 | Exon (10) | 2610..2703 | Exon (11) | 2704..2913 | Exon (12) | 2914..3060 | Exon (13) | 3061..3226 | Exon (14) | 3227..3328 | Exon (15) | 3329..3535 | Exon (16) | 3536..3616 | Exon (17) | 3617..3798 | Exon (18) | 3799..3908 | Exon (19) | 3909..4074 | Exon (20) | 4075..4211 | Exon (21) | 4212..4772 |
| Translation | MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT
KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAW
HFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV
GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLG
ILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSG
LALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAEVKDVLIPHERV
VTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLNH
PNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYLA
EQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ
TYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVM
QQCWEADPAVRPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQF
SPMPGNVRRPRPLSEPPRPT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(198) | - | , g | dbSNP:72040386 |
| complement(351) | - | g, c | dbSNP:75065900 |
| complement(474) | - | c, a | dbSNP:74647188 |
| complement(487) | - | t, g | dbSNP:35887539 |
| complement(495) | - | t, g | dbSNP:56204949 |
| complement(547) | - | t, g | dbSNP:55908300 |
| complement(601) | - | t, c | dbSNP:3733136 |
| complement(623..624) | - | , tg | dbSNP:72242009 |
| complement(808) | - | g, a | dbSNP:13318943 |
| complement(817) | - | g, a | dbSNP:55633379 |
| 1229 | + | a, g | dbSNP:2230593 |
| complement(1314) | - | t, a | dbSNP:116112089 |
| complement(1331) | - | t, c | dbSNP:35924402 |
| 1565 | + | c, t | dbSNP:2230591 |
| 1583 | + | a, g | dbSNP:2230592 |
| complement(1635) | - | g, a | dbSNP:56131227 |
| complement(1658) | - | t, c | dbSNP:34564898 |
| complement(1752) | - | t, c | dbSNP:55898810 |
| complement(1774) | - | g, a | dbSNP:34350470 |
| complement(1813..1814) | - | , t | dbSNP:34211295 |
| 1832 | + | a, g | dbSNP:2230590 |
| complement(1956) | - | t, c | dbSNP:78797739 |
| complement(2091) | - | g, a | dbSNP:56273948 |
| complement(2102) | - | t, g | dbSNP:35986685 |
| complement(2125) | - | t, a | dbSNP:9819888 |
| complement(2332) | - | g, a | dbSNP:61734381 |
| complement(2508..2509) | - | , g | dbSNP:67360293 |
| complement(2817) | - | g, c | dbSNP:41291714 |
| complement(2954) | - | , t | dbSNP:66589847 |
| complement(2962) | - | t, c | dbSNP:56091918 |
| complement(2985) | - | g, a | dbSNP:61729096 |
| complement(3017..3018) | - | , g | dbSNP:66570013 |
| complement(3100) | - | t, c | dbSNP:13078735 |
| complement(3357) | - | , g | dbSNP:67811243 |
| complement(3609) | - | t, c | dbSNP:113880182 |
| complement(3679) | - | t, c | dbSNP:115306809 |
| complement(3777..3778) | - | , a | dbSNP:34740617 |
| complement(3847) | - | t, c | dbSNP:7433231 |
| complement(3957) | - | g, a | dbSNP:55968312 |
| 4260 | + | c, t | dbSNP:5030975 |
| 4267 | + | a, g | dbSNP:1062633 |
| complement(4310) | - | c, a | dbSNP:112748721 |
| complement(4343) | - | t, c | dbSNP:56330223 |
| complement(4370) | - | t, c | dbSNP:56066753 |
| complement(4395) | - | t, c | dbSNP:12634102 |
| complement(4722) | - | t, g | dbSNP:79328051 |
| Gene Symbol | MST1R |
| Gene Synonym | CD136; CDw136; PTK8; RON |
| Chromosome | 3 |
| Locus Map | 3p21.3 |
| All Transcripts | NM_002447 |
| Title | Ron kinase transphosphorylation sustains MET oncogene addiction . |
| Author | Benvenuti,S., Lazzari,L., Arnesano,A., Li Chiavi,G., Gentile,A. and Comoglio,P.M. |
| Journal | Cancer Res. 71 (5), 1945-1955 (2011) |
| Title | MSP-induced RON activation upregulates uPAR expression and cell invasiveness via MAPK, AP-1 and NF-kappaB signals in gastric cancer cells . |
| Author | Park,J.S., Park,J.H., Khoi,P.N., Joo,Y.E. and Jung,Y.D. |
| Journal | Carcinogenesis 32 (2), 175-181 (2011) |
| Title | Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study . |
| Author | Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H., Schreiber,S. and Nebel,A. |
| Journal | Mutat. Res. 694 (1-2), 13-19 (2010) |
| Title | Ron receptor tyrosine kinase activation confers resistance to tamoxifen in breast cancer cell lines . |
| Author | McClaine,R.J., Marshall,A.M., Wagh,P.K. and Waltz,S.E. |
| Journal | Neoplasia 12 (8), 650-658 (2010) |
| Title | Deletion or insertion in the first immunoglobulin-plexin-transcription (IPT) domain differentially regulates expression and tumorigenic activities of RON receptor Tyrosine Kinase . |
| Author | Ma,Q., Zhang,K., Guin,S., Zhou,Y.Q. and Wang,M.H. |
| Journal | Mol. Cancer 9, 307 (2010) |
| Title | Macrophage-stimulating protein activates Ras by both activation and translocation of SOS nucleotide exchange factor . |
| Author | Li,B.Q., Wang,M.H., Kung,H.F., Ronsin,C., Breathnach,R., Leonard,E.J. and Kamata,T. |
| Journal | Biochem. Biophys. Res. Commun. 216 (1), 110-118 (1995) |
| Title | Identification of the ron gene product as the receptor for the human macrophage stimulating protein . |
| Author | Wang,M.H., Ronsin,C., Gesnel,M.C., Coupey,L., Skeel,A., Leonard,E.J. and Breathnach,R. |
| Journal | Science 266 (5182), 117-119 (1994) |
| Title | RON is a heterodimeric tyrosine kinase receptor activated by the . |
| Author | Gaudino,G., Follenzi,A., Naldini,L., Collesi,C., Santoro,M., Gallo,K.A., Godowski,P.J. and Comoglio,P.M. |
| Journal | EMBO J. 13 (15), 3524-3532 (1994) |
| Title | A survey of protein tyrosine kinase mRNAs expressed in normal human melanocytes . |
| Author | Lee,S.T., Strunk,K.M. and Spritz,R.A. |
| Journal | Oncogene 8 (12), 3403-3410 (1993) |
| Title | A novel putative receptor protein tyrosine kinase of the met family . |
| Author | Ronsin,C., Muscatelli,F., Mattei,M.G. and Breathnach,R. |
| Journal | Oncogene 8 (5), 1195-1202 (1993) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |