• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens macrophage stimulating 1 receptor (c-met-related tyrosine kinase) (MST1R), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002447 Homo sapiens macrophage stimulating 1 receptor (c-met-related tyrosine kinase) (MST1R), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $1198.00 $1149.00 16

*Business Day

Related Services

RefSeq Version NM_002447.2, 153946392
Length 4785 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens macrophage stimulating 1 receptor (c-met-related tyrosine kinase) (MST1R), transcript variant 1, mRNA.
Product macrophage-stimulating protein receptor isoform 1 preproprotein
Comment

Summary: This gene encodes a cell surface receptor for macrophage-stimulating protein (MSP) with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-chain precursor. The beta subunit undergoes tyrosine phosphorylation upon stimulation by MSP. This protein is expressed on the ciliated epithelia of the mucociliary transport apparatus of the lung, and together with MSP, thought to be involved in host defense. Alternatively spliced transcript variants encoding different isoforms with different structural and biochemical properties have been described (PMID:8816464). [provided by RefSeq, Oct 2011].


Transcript Variant: This variant (1) encodes the longer isoform (1, also known as isoform Ron).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data.

RefSeq NP_002438.2
CDS 265..4467
Misc Feature(1)343..1833
Misc Feature(2)454..1761
Misc Feature(3)order(643..651,769..771,838..843,922..924,928..930,
Misc Feature(4)1840..1968
Misc Feature(5)1969..2313
Misc Feature(6)2314..2568
Misc Feature(7)2572..>2766
Misc Feature(8)3136..3198
Misc Feature(9)3517..4278
Misc Feature(10)3520..4305
Misc Feature(11)order(3526..3543,3550..3552,3598..3600,3604..3606,
Misc Feature(12)order(3526..3534,3541..3543,3550..3552,3598..3600,
Misc Feature(13)order(3886..3888,3898..3900,4000..4014,4039..4041,
Misc Feature(14)order(3937..3996,4000..4020)
Misc Feature(15)4321..4323
Misc Feature(16)4342..4344
Exon (1)1..1494
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (2)1495..1683
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (3)1684..1812
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (4)1813..1983
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (5)1984..2144
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (6)2145..2310
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (7)2311..2447
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (8)2448..2609
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (9)2610..2703
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (10)2704..2913
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (11)2914..3060
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (12)3061..3226
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (13)3227..3328
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (14)3329..3535
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (15)3536..3616
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (16)3617..3798
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (17)3799..3908
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (18)3909..4074
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (19)4075..4211
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Exon (20)4212..4772
Gene:MST1R
Gene Synonym:CD136; CDw136; PTK8; RON
Translation MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAW HFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN GTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLG ILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSG LALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAEVKDVLIPHERV VTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLNH PNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYLA EQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ TYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVM QQCWEADPAVRPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQF SPMPGNVRRPRPLSEPPRPT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(198)-dbSNP:
complement(198)-, gdbSNP:72040386
complement(282)-t, cdbSNP:145591334
complement(290)-t, gdbSNP:200935978
complement(311)-g, adbSNP:149709041
complement(329)-g, adbSNP:140992621
complement(368)-g, adbSNP:139899091
complement(379)-t, cdbSNP:142478095
complement(418)-t, cdbSNP:144338909
complement(449)-t, cdbSNP:201965059
complement(487)-t, gdbSNP:35887539
complement(495)-t, gdbSNP:56204949
complement(517)-g, cdbSNP:140399231
complement(547)-t, gdbSNP:55908300
complement(573)-t, cdbSNP:200343487
complement(577)-t, cdbSNP:201288866
complement(601)-t, cdbSNP:3733136
complement(623..624)-, tgdbSNP:72242009
complement(647)-g, adbSNP:150064162
complement(660)-g, cdbSNP:143144426
complement(673)-t, adbSNP:147611537
complement(700)-g, adbSNP:200634648
complement(741)-t, cdbSNP:201186157
complement(777)-g, adbSNP:141636513
complement(789)-g, adbSNP:147878512
complement(790)-t, cdbSNP:151106960
complement(808)-g, adbSNP:13318943
complement(817)-g, adbSNP:55633379
complement(858)-g, adbSNP:200307089
complement(882)-g, adbSNP:139157266
complement(904)-g, adbSNP:149238234
complement(913)-g, adbSNP:150176814
complement(936)-t, gdbSNP:201910184
complement(949)-t, cdbSNP:143724913
complement(954)-t, cdbSNP:146972436
complement(1038)-g, adbSNP:147876136
complement(1055)-g, adbSNP:200938217
complement(1056)-t, cdbSNP:200272478
complement(1069)-t, cdbSNP:145173827
complement(1089)-g, adbSNP:200038223
complement(1099)-g, adbSNP:201211696
complement(1100)-t, cdbSNP:139753578
complement(1151)-g, adbSNP:143752852
complement(1181)-g, cdbSNP:200046052
complement(1190)-t, g, cdbSNP:150736542
complement(1195)-t, cdbSNP:201805638
complement(1226)-g, adbSNP:199936316
complement(1229)-g, adbSNP:2230593
complement(1242)-g, adbSNP:143735950
complement(1243)-t, cdbSNP:200757776
complement(1270)-t, cdbSNP:146988970
complement(1282)-t, cdbSNP:201546006
complement(1314)-t, adbSNP:199531010
complement(1331)-t, cdbSNP:35924402
complement(1450)-g, adbSNP:200626206
complement(1457)-g, adbSNP:199980524
complement(1458)-g, adbSNP:200286403
complement(1493)-g, adbSNP:138579438
complement(1565)-dbSNP:
complement(1565)-t, cdbSNP:2230591
complement(1566)-t, gdbSNP:143634317
complement(1568)-t, cdbSNP:200724473
complement(1583)-g, adbSNP:2230592
complement(1627)-g, adbSNP:199940178
complement(1629)-t, gdbSNP:143816851
complement(1635)-g, adbSNP:56131227
complement(1643)-g, adbSNP:149702837
complement(1648)-c, adbSNP:139493185
complement(1658)-t, cdbSNP:34564898
complement(1711)-dbSNP:
complement(1711)-g, adbSNP:202096597
complement(1743)-g, adbSNP:199937670
complement(1752)-t, cdbSNP:55898810
complement(1756)-t, cdbSNP:148258933
complement(1768)-t, cdbSNP:149591175
complement(1774)-g, adbSNP:34350470
complement(1775)-t, c, adbSNP:138183686
complement(1795)-g, adbSNP:138805980
complement(1813..1814)-dbSNP:
complement(1813..1814)-, tdbSNP:34211295
complement(1822)-t, cdbSNP:200821496
complement(1831)-g, cdbSNP:141097970
complement(1832)-g, adbSNP:2230590
complement(1867)-g, cdbSNP:201544530
complement(1906)-c, adbSNP:201252584
complement(1920)-g, adbSNP:149064521
complement(1956)-t, cdbSNP:78797739
complement(1958)-t, gdbSNP:144558604
complement(1987)-dbSNP:
complement(1987)-g, adbSNP:191131637
complement(1993)-t, gdbSNP:142020857
complement(2078)-t, cdbSNP:200292266
complement(2091)-g, adbSNP:56273948
complement(2102)-t, gdbSNP:35986685
complement(2125)-t, adbSNP:9819888
complement(2133)-g, cdbSNP:147926223
complement(2273)-dbSNP:
complement(2273)-c, adbSNP:201024956
complement(2332)-dbSNP:
complement(2332)-g, adbSNP:61734381
complement(2351)-t, cdbSNP:148694532
complement(2388)-c, adbSNP:145062208
complement(2446)-g, adbSNP:201008581
complement(2463)-dbSNP:
complement(2463)-g, cdbSNP:139163994
complement(2490)-g, adbSNP:142084339
complement(2503)-c, adbSNP:141826709
complement(2508..2509)-, gdbSNP:67360293
complement(2558)-t, cdbSNP:200242275
complement(2578)-t, cdbSNP:148081612
complement(2597)-t, gdbSNP:149428633
complement(2617)-dbSNP:
complement(2617)-g, adbSNP:199894526
complement(2817)-dbSNP:
complement(2817)-g, cdbSNP:41291714
complement(2822)-g, adbSNP:199940953
complement(2837)-t, cdbSNP:140736052
complement(2870)-t, cdbSNP:142731739
complement(2928)-dbSNP:
complement(2928)-g, adbSNP:146729532
complement(2954)-, tdbSNP:66589847
complement(2962)-t, cdbSNP:56091918
complement(2985)-g, adbSNP:61729096
complement(2993)-t, cdbSNP:201953002
complement(3022..3023)-, gdbSNP:66570013
complement(3034)-g, adbSNP:149584908
complement(3047)-g, cdbSNP:150824053
complement(3087)-dbSNP:
complement(3087)-g, adbSNP:201143544
complement(3091)-t, cdbSNP:147303179
complement(3100)-t, cdbSNP:13078735
complement(3102)-t, cdbSNP:143962638
complement(3103)-g, adbSNP:199970256
complement(3113)-g, adbSNP:201836399
complement(3134)-g, adbSNP:143096514
complement(3146)-g, adbSNP:199618569
complement(3183)-t, cdbSNP:150284041
complement(3199)-t, cdbSNP:201567076
complement(3211)-g, adbSNP:200766923
complement(3305)-dbSNP:
complement(3305)-c, adbSNP:146747970
complement(3357)-dbSNP:
complement(3357)-, gdbSNP:67811243
complement(3387)-g, adbSNP:150981774
complement(3388)-c, adbSNP:144684048
complement(3421)-g, adbSNP:144584611
complement(3459)-t, cdbSNP:147333195
complement(3494)-t, gdbSNP:200499140
complement(3586)-dbSNP:
complement(3586)-g, adbSNP:150876558
complement(3587)-c, adbSNP:147999292
complement(3594)-t, cdbSNP:200571761
complement(3609)-t, cdbSNP:113880182
complement(3652)-dbSNP:
complement(3652)-g, adbSNP:200454353
complement(3671)-t, cdbSNP:140250708
complement(3687)-t, cdbSNP:138521247
complement(3778..3779)-, adbSNP:34740617
complement(3779)-g, adbSNP:201123555
complement(3831)-dbSNP:
complement(3831)-t, gdbSNP:141111005
complement(3844)-g, adbSNP:149920380
complement(3847)-t, cdbSNP:7433231
complement(3915)-dbSNP:
complement(3915)-g, adbSNP:140747428
complement(3956)-t, cdbSNP:199869962
complement(3957)-g, adbSNP:55968312
complement(3964)-g, adbSNP:150116910
complement(3971)-g, cdbSNP:139861776
complement(3980)-t, cdbSNP:200817733
complement(3988)-g, cdbSNP:150754921
complement(3995)-t, cdbSNP:201718182
complement(4011)-t, cdbSNP:146278360
complement(4013)-g, adbSNP:144565670
complement(4123..4124)-dbSNP:
complement(4123..4124)-, ggdbSNP:145238152
complement(4160)-g, adbSNP:200413203
complement(4172)-t, cdbSNP:148051512
complement(4260)-dbSNP:
complement(4260)-t, cdbSNP:5030975
complement(4261)-t, cdbSNP:200341395
complement(4266)-g, adbSNP:145556678
complement(4267)-g, adbSNP:1062633
complement(4281)-t, cdbSNP:151334000
complement(4285)-t, cdbSNP:201481391
complement(4287)-t, cdbSNP:148949881
complement(4290)-t, cdbSNP:142449796
complement(4297)-t, cdbSNP:141643217
complement(4308)-t, cdbSNP:145780232
complement(4310)-c, adbSNP:112748721
complement(4336)-g, cdbSNP:145944620
complement(4343)-t, cdbSNP:56330223
complement(4346)-g, adbSNP:200332639
complement(4370)-t, cdbSNP:56066753
complement(4385)-t, cdbSNP:202007332
complement(4395)-t, cdbSNP:12634102
complement(4418)-c, adbSNP:137882771
complement(4430)-t, cdbSNP:202219889
complement(4444)-t, adbSNP:141338964
complement(4456)-g, adbSNP:148258453
complement(4648)-g, adbSNP:138662147
complement(4722)-t, gdbSNP:79328051
complement(4757)-t, gdbSNP:144079661
Gene SymbolMST1R
Gene SynonymCD136; CDw136; PTK8; RON
Chromosome3
Locus Map3p21.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001244937 Homo sapiens macrophage stimulating 1 receptor (c-met-related tyrosine kinase) (MST1R), transcript variant 2, mRNA. On-demand $1699.00 25
NM_002447 Homo sapiens macrophage stimulating 1 receptor (c-met-related tyrosine kinase) (MST1R), transcript variant 1, mRNA. In-stock $1198.00 $1149.00 16
Title The short form of RON is expressed in acute myeloid leukemia and sensitizes leukemic cells to cMET inhibitors .
Author Fialin,C., Larrue,C., Vergez,F., Sarry,J.E., Bertoli,S., Mansat-De Mas,V., Demur,C., Delabesse,E., Payrastre,B., Manenti,S., Roche,S. and Recher,C.
Journal Leukemia 27 (2), 325-335 (2013)
Title A novel variant of the RON receptor tyrosine kinase derived from colorectal carcinoma cells which lacks tyrosine phosphorylation but induces cell migration .
Author Wang,D., Lao,W.F., Kuang,Y.Y., Geng,S.M., Mo,L.J. and He,C.
Journal Exp. Cell Res. 318 (20), 2548-2558 (2012)
Title Identification of novel splicing variants from RON proto-oncogene pre-mRNA .
Author Moon,H., Cho,S., Yang,X., Zhou,J., Loh,T.J., Zheng,X. and Shen,H.
Journal Oncol. Rep. 28 (6), 2217-2220 (2012)
Title Involvement of recepteur d'origine nantais receptor tyrosine kinase in Epstein-Barr virus-associated nasopharyngeal carcinoma and its metastasis .
Author Chou,Y.C., Chen,C.L., Yeh,T.H., Lin,S.J., Chen,M.R., Doong,S.L., Lu,J. and Tsai,C.H.
Journal Am. J. Pathol. 181 (5), 1773-1781 (2012)
Title Expression of RON in colorectal cancer and its relationships with tumor cell behavior and prognosis .
Author Park,Y.L., Lee,G.H., Kim,K.Y., Myung,E., Kim,J.S., Myung,D.S., Park,K.J., Cho,S.B., Lee,W.S., Jung,Y.D., Kim,H.S. and Joo,Y.E.
Journal Tumori 98 (5), 652-662 (2012)
Title A splicing variant of the RON transcript induces constitutive tyrosine kinase activity and an invasive phenotype .
Author Collesi,C., Santoro,M.M., Gaudino,G. and Comoglio,P.M.
Journal Mol. Cell. Biol. 16 (10), 5518-5526 (1996)
Title Macrophage-stimulating protein activates Ras by both activation and translocation of SOS nucleotide exchange factor .
Author Li,B.Q., Wang,M.H., Kung,H.F., Ronsin,C., Breathnach,R., Leonard,E.J. and Kamata,T.
Journal Biochem. Biophys. Res. Commun. 216 (1), 110-118 (1995)
Title Identification of the ron gene product as the receptor for the human macrophage stimulating protein .
Author Wang,M.H., Ronsin,C., Gesnel,M.C., Coupey,L., Skeel,A., Leonard,E.J. and Breathnach,R.
Journal Science 266 (5182), 117-119 (1994)
Title RON is a heterodimeric tyrosine kinase receptor activated by the .
Author Gaudino,G., Follenzi,A., Naldini,L., Collesi,C., Santoro,M., Gallo,K.A., Godowski,P.J. and Comoglio,P.M.
Journal EMBO J. 13 (15), 3524-3532 (1994)
Title A survey of protein tyrosine kinase mRNAs expressed in normal human melanocytes .
Author Lee,S.T., Strunk,K.M. and Spritz,R.A.
Journal Oncogene 8 (12), 3403-3410 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.