• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens msh homeobox 2 (MSX2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002449 Homo sapiens msh homeobox 2 (MSX2), mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 TBD

*Business Day

Related Services

RefSeq Version NM_002449.4, 84452153
Length 2224 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens msh homeobox 2 (MSX2), mRNA.
Product homeobox protein MSX-2
Comment

Summary: This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. [provided by RefSeq, Jul 2008].

RefSeq NP_002440.2
CDS 89..892
Misc Feature(1)74..76
Misc Feature(2)515..691
Misc Feature(3)515..691
Misc Feature(4)order(515..529,533..535,584..586,602..604,641..643,
Misc Feature(5)order(521..523,530..532,650..652,659..664,671..673)
Exon (1)1..467
Gene:MSX2
Gene Synonym:CRS2; FPP; HOX8; MSH; PFM; PFM1
Exon (2)468..2208
Gene:MSX2
Gene Synonym:CRS2; FPP; HOX8; MSH; PFM; PFM1
Translation MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPK EASPLPAESASAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPG RYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLN LTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSSFSLPFPISSPLQAASIYGASY PFHRPVLPIPPVGLYATPVGYGMYHLS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
33+dbSNP:
33+a, cdbSNP:113874536
41+a, gdbSNP:191789843
72+c, gdbSNP:4647952
96+c, tdbSNP:201724372
184+, gdbSNP:34093690
242+a, cdbSNP:35902803
353..354+gc, tadbSNP:121912971
433+, gdbSNP:121912972
474+c, tdbSNP:4242182
475+c, gdbSNP:186769394
523+a, gdbSNP:189666650
531+a, cdbSNP:104893895
532+c, tdbSNP:200762790
570+a, tdbSNP:200519800
603+a, gdbSNP:104893896
654+g, tdbSNP:61743524
679+a, gdbSNP:150352201
684+g, tdbSNP:199732800
692+c, gdbSNP:182690432
701+c, tdbSNP:111542301
786+c, tdbSNP:138053303
787+a, gdbSNP:201880865
811+a, gdbSNP:201103544
831+a, cdbSNP:61739543
841+c, tdbSNP:61739546
877+a, gdbSNP:199856192
1049+a, gdbSNP:17063878
1058+g, tdbSNP:3087539
1078+c, tdbSNP:3087537
1113+c, tdbSNP:3087538
1149+c, tdbSNP:187794452
1197+c, tdbSNP:143672195
1241+c, tdbSNP:114567531
1258+g, tdbSNP:193163747
1308+a, cdbSNP:10038500
1358+a, gdbSNP:148083483
1402+a, gdbSNP:2381939
1455+a, gdbSNP:143924110
1478+c, tdbSNP:185029831
1490+c, tdbSNP:189138878
1527+a, gdbSNP:192627117
1550+c, tdbSNP:10044147
1580+a, gdbSNP:184884082
1615+a, cdbSNP:115604243
1673+a, gdbSNP:188468287
1696+c, gdbSNP:180684930
1759+g, tdbSNP:34342523
1886..1887+, adbSNP:76722740
1890..1891+, adbSNP:59205443
1899+a, tdbSNP:74292295
1942+c, tdbSNP:184931219
1956+a, gdbSNP:189444818
1972..1973+, gdbSNP:145784193
1978..1979+, gdbSNP:201885089
2017+a, gdbSNP:14459
2038+c, tdbSNP:2890848
2068+c, gdbSNP:2890849
2070+c, tdbSNP:182072112
2081+a, gdbSNP:146501739
2098+c, tdbSNP:77229212
2141+c, tdbSNP:139249455
2142+a, gdbSNP:143253235
2199..2200+, gctdbSNP:200120254
Gene SymbolMSX2
Gene SynonymCRS2; FPP; HOX8; MSH; PFM; PFM1
Chromosome5
Locus Map5q35.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002449 Homo sapiens msh homeobox 2 (MSX2), mRNA. In-stock $348.00 $299.00 TBD
Title PKC signaling inhibits osteogenic differentiation through the regulation of Msx2 function .
Author Jeong,H.M., Jin,Y.H., Choi,Y.H., Yum,J., Choi,J.K., Yeo,C.Y. and Lee,K.Y.
Journal Biochim. Biophys. Acta 1823 (8), 1225-1232 (2012)
Title Microduplications upstream of MSX2 are associated with a phenocopy of cleidocranial dysplasia .
Author Ott,C.E., Hein,H., Lohan,S., Hoogeboom,J., Foulds,N., Grunhagen,J., Stricker,S., Villavicencio-Lorini,P., Klopocki,E. and Mundlos,S.
Journal J. Med. Genet. 49 (7), 437-441 (2012)
Title [Expression and significance of Msx2 and topo II-alpha in sinonasal inverted papilloma] .
Author Wu,Q., Yang,Y., Wu,X., Zhao,C., Cong,L., Ruan,B. and Zhang,J.
Journal Lin Chung Er Bi Yan Hou Tou Jing Wai Ke Za Zhi 26 (8), 343-346 (2012)
Title [Changes in the expression of Dlx5, Msx2, and Dlx5/Msx2 in hPDLSCs loaded with cyclic tensile stress] .
Author Sun,C.X., Zhang,L.K., Feng,X.X. and Zhao,Z.H.
Journal Sichuan Da Xue Xue Bao Yi Xue Ban 42 (6), 823-826 (2011)
Title Functional and prognostic relevance of the homeobox protein MSX2 in malignant melanoma .
Author Gremel,G., Ryan,D., Rafferty,M., Lanigan,F., Hegarty,S., Lavelle,M., Murphy,I., Unwin,L., Joyce,C., Faller,W., McDermott,E.W., Sheahan,K., Ponten,F. and Gallagher,W.M.
Journal Br. J. Cancer 105 (4), 565-574 (2011)
Title DNA binding and transcriptional properties of wild-type and mutant forms of the homeodomain protein Msx2 .
Author Semenza,G.L., Wang,G.L. and Kundu,R.
Journal Biochem. Biophys. Res. Commun. 209 (1), 257-262 (1995)
Title [Molecular cloning and expression of homeobox-containing genes during hard tissue development] .
Author Iimura,T.
Journal Kokubyo Gakkai Zasshi 61 (4), 590-604 (1994)
Title A mutation in the homeodomain of the human MSX2 gene in a family affected with autosomal dominant craniosynostosis .
Author Jabs,E.W., Muller,U., Li,X., Ma,L., Luo,W., Haworth,I.S., Klisak,I., Sparkes,R., Warman,M.L., Mulliken,J.B. et al.
Journal Cell 75 (3), 443-450 (1993)
Title Expression of a human homeobox-containing gene is regulated by 1,25(OH)2D3 in bone cells .
Author Hodgkinson,J.E., Davidson,C.L., Beresford,J. and Sharpe,P.T.
Journal Biochim. Biophys. Acta 1174 (1), 11-16 (1993)
Title Over-expression of HOX-8, the human homologue of the mouse Hox-8 homeobox gene, in human tumors .
Author Suzuki,M., Tanaka,M., Iwase,T., Naito,Y., Sugimura,H. and Kino,I.
Journal Biochem. Biophys. Res. Commun. 194 (1), 187-193 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.