• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens msh homeobox 2 (MSX2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21502 Homo sapiens msh homeobox 2 (MSX2), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu21502C Homo sapiens msh homeobox 2 (MSX2), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002449.4, 84452153
Length 804 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens msh homeobox 2 (MSX2), mRNA.
Product homeobox protein MSX-2
Comment

Summary: This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. [provided by RefSeq, Jul 2008].

RefSeq NP_002440.2
CDS 89..892
Misc Feature(1)74..76
Misc Feature(2)515..691
Misc Feature(3)515..691
Misc Feature(4)order(515..529,533..535,584..586,602..604,641..643,
Misc Feature(5)order(521..523,530..532,650..652,659..664,671..673)
Exon (1)1..467
Gene:MSX2
Gene Synonym:CRS2; FPP; HOX8; MSH; PFM; PFM1
Exon (2)468..2208
Gene:MSX2
Gene Synonym:CRS2; FPP; HOX8; MSH; PFM; PFM1
Translation MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPK EASPLPAESASAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPG RYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLN LTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSSFSLPFPISSPLQAASIYGASY PFHRPVLPIPPVGLYATPVGYGMYHLS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
4+dbSNP:
4+a, cdbSNP:373735781
33+a, cdbSNP:113874536
39+c, tdbSNP:371076863
41+a, gdbSNP:191789843
72+c, gdbSNP:4647952
96+c, tdbSNP:201724372
111+a, gdbSNP:367636705
118+a, gdbSNP:371794345
188+, gdbSNP:34093690
205+c, tdbSNP:376630472
242+a, cdbSNP:35902803
343+c, tdbSNP:367614252
353..354+gc, tadbSNP:121912971
426+c, tdbSNP:367897914
433+, gdbSNP:121912972
461+c, tdbSNP:372131169
474+c, tdbSNP:4242182
475+c, gdbSNP:186769394
523+a, gdbSNP:189666650
531+a, cdbSNP:104893895
532+c, tdbSNP:200762790
570+a, tdbSNP:200519800
603+a, gdbSNP:104893896
610+a, gdbSNP:370893406
654+g, tdbSNP:61743524
679+a, gdbSNP:150352201
684+g, tdbSNP:199732800
692+c, gdbSNP:182690432
701+c, tdbSNP:111542301
771+c, tdbSNP:373857075
786+c, tdbSNP:138053303
787+a, gdbSNP:201880865
810+c, tdbSNP:368570722
811+a, gdbSNP:201103544
814+a, cdbSNP:371825159
831+a, cdbSNP:61739543
837+c, tdbSNP:374244313
877+a, gdbSNP:199856192
897+g, tdbSNP:368747209
907+a, gdbSNP:372223571
938+g, tdbSNP:375964205
967+a, cdbSNP:369125868
1049+a, gdbSNP:17063878
1058+g, tdbSNP:3087539
1078+c, tdbSNP:3087537
1113+c, tdbSNP:3087538
1149+c, tdbSNP:187794452
1197+c, tdbSNP:143672195
1241+c, tdbSNP:114567531
1255+a, gdbSNP:376258231
1258+g, tdbSNP:193163747
1308+a, cdbSNP:10038500
complement(1358)-g, adbSNP:148083483
1402+a, gdbSNP:2381939
1455+a, gdbSNP:143924110
1478+c, tdbSNP:185029831
1490+c, tdbSNP:189138878
1527+a, gdbSNP:192627117
1550+c, tdbSNP:10044147
1580+a, gdbSNP:184884082
1615+a, cdbSNP:115604243
1673+a, gdbSNP:188468287
1696+c, gdbSNP:180684930
complement(1759)-t, gdbSNP:34342523
1889..1890+, adbSNP:59205443
1898..1899+, adbSNP:397692104
1899+a, tdbSNP:74292295
1942+c, tdbSNP:184931219
1956+a, gdbSNP:189444818
1972..1973+, gdbSNP:145784193
2017+a, gdbSNP:14459
2038+c, tdbSNP:2890848
2068+c, gdbSNP:2890849
2070+c, tdbSNP:182072112
2081+a, gdbSNP:146501739
2098+c, tdbSNP:77229212
2116+a, cdbSNP:373056463
2141+c, tdbSNP:139249455
2142+a, gdbSNP:143253235
2199..2200+, gctdbSNP:200120254
Gene SymbolMSX2
Gene SynonymCRS2; FPP; HOX8; MSH; PFM; PFM1
Chromosome5
Locus Map5q35.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002449 Homo sapiens msh homeobox 2 (MSX2), mRNA. In-stock $99.00 TBD
NM_002449 Homo sapiens msh homeobox 2 (MSX2), mRNA. In-stock $99.00 TBD
Title PKC signaling inhibits osteogenic differentiation through the regulation of Msx2 function .
Author Jeong HM, Jin YH, Choi YH, Yum J, Choi JK, Yeo CY and Lee KY.
Journal Biochim. Biophys. Acta 1823 (8), 1225-1232 (2012)
Title Microduplications upstream of MSX2 are associated with a phenocopy of cleidocranial dysplasia .
Author Ott CE, Hein H, Lohan S, Hoogeboom J, Foulds N, Grunhagen J, Stricker S, Villavicencio-Lorini P, Klopocki E and Mundlos S.
Journal J. Med. Genet. 49 (7), 437-441 (2012)
Title [Expression and significance of Msx2 and topo II-alpha in sinonasal inverted papilloma] .
Author Wu Q, Yang Y, Wu X, Zhao C, Cong L, Ruan B and Zhang J.
Journal Lin Chung Er Bi Yan Hou Tou Jing Wai Ke Za Zhi 26 (8), 343-346 (2012)
Title [Changes in the expression of Dlx5, Msx2, and Dlx5/Msx2 in hPDLSCs loaded with cyclic tensile stress] .
Author Sun CX, Zhang LK, Feng XX and Zhao ZH.
Journal Sichuan Da Xue Xue Bao Yi Xue Ban 42 (6), 823-826 (2011)
Title Functional and prognostic relevance of the homeobox protein MSX2 in malignant melanoma .
Author Gremel G, Ryan D, Rafferty M, Lanigan F, Hegarty S, Lavelle M, Murphy I, Unwin L, Joyce C, Faller W, McDermott EW, Sheahan K, Ponten F and Gallagher WM.
Journal Br. J. Cancer 105 (4), 565-574 (2011)
Title DNA binding and transcriptional properties of wild-type and mutant forms of the homeodomain protein Msx2 .
Author Semenza GL, Wang GL and Kundu R.
Journal Biochem. Biophys. Res. Commun. 209 (1), 257-262 (1995)
Title [Molecular cloning and expression of homeobox-containing genes during hard tissue development] .
Author Iimura T.
Journal Kokubyo Gakkai Zasshi 61 (4), 590-604 (1994)
Title Expression of a human homeobox-containing gene is regulated by 1,25(OH)2D3 in bone cells .
Author Hodgkinson JE, Davidson CL, Beresford J and Sharpe PT.
Journal Biochim. Biophys. Acta 1174 (1), 11-16 (1993)
Title Over-expression of HOX-8, the human homologue of the mouse Hox-8 homeobox gene, in human tumors .
Author Suzuki M, Tanaka M, Iwase T, Naito Y, Sugimura H and Kino I.
Journal Biochem. Biophys. Res. Commun. 194 (1), 187-193 (1993)
Title Enlarged Parietal Foramina .
Author Wilkie,A.O.M. and Mavrogiannis,L.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.