• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002456 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_002456.5, 324120948
Length 1220 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 1, mRNA.
Product mucin-1 isoform 1 precursor
Comment

Summary: This gene encodes a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in intracellular signaling. This protein is expressed on the apical surface of epithelial cells that line the mucosal surfaces of many different tissues including lung, breast stomach and pancreas. This protein is proteolytically cleaved into alpha and beta subunits that form a heterodimeric complex. The N-terminal alpha subunit functions in cell-adhesion and the C-terminal beta subunit is involved in cell signaling. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is known to contain a highly polymorphic variable number tandem repeats (VNTR) domain. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2011].


Transcript Variant: This variant (1) represents isoform 1.

RefSeq NP_002447.4
CDS 73..894
Misc Feature(1)73..141
Misc Feature(2)151..153
Misc Feature(3)235..582
Misc Feature(4)289..291
Misc Feature(5)415..417
Misc Feature(6)523..525
Misc Feature(7)697..699
Misc Feature(8)733..735
Misc Feature(9)751..753
Misc Feature(10)760..762
Misc Feature(11)796..798
Misc Feature(12)805..807
Misc Feature(13)811..813
Misc Feature(14)853..855
Exon (1)1..130
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (2)131..231
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (3)232..354
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (4)355..410
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (5)411..547
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (6)548..669
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (7)670..819
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Exon (8)820..1205
Gene:MUC1
Gene Synonym:ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Translation MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNALSTGVSF FFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQ LTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIA LLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPS STDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
2+dbSNP:
2+a, gdbSNP:11465204
complement(20)-g, adbSNP:372118515
complement(24)-g, adbSNP:368256181
complement(80)-g, adbSNP:376608767
complement(81)-t, cdbSNP:373505102
complement(92)-g, cdbSNP:368800613
complement(103)-g, adbSNP:377356836
complement(137)-dbSNP:
complement(137)-g, adbSNP:139437006
138+a, gdbSNP:4072037
complement(155)-c, adbSNP:145108039
complement(158)-g, adbSNP:145667707
complement(170)-t, cdbSNP:201761107
complement(182)-g, adbSNP:201186912
complement(192)-g, cdbSNP:199568358
complement(213)-t, g, adbSNP:145691584
complement(216)-g, adbSNP:200478078
complement(270)-dbSNP:
complement(270)-g, adbSNP:371485486
complement(295)-t, adbSNP:35819649
complement(307)-g, adbSNP:146950322
complement(378)-dbSNP:
complement(378)-t, cdbSNP:140871200
complement(399)-g, adbSNP:370819310
complement(416)-dbSNP:
complement(416)-c, adbSNP:145224844
complement(418)-t, adbSNP:373382247
complement(432)-t, cdbSNP:139620330
complement(453)-t, cdbSNP:370391810
complement(472)-c, adbSNP:144273480
complement(475)-t, g, adbSNP:1611770
complement(491)-t, cdbSNP:200411609
complement(492)-t, adbSNP:41264913
complement(530)-g, adbSNP:146141676
complement(531)-t, cdbSNP:201798179
complement(547)-t, cdbSNP:201815857
complement(551)-dbSNP:
complement(551)-g, adbSNP:11465207
complement(551)-g, adbSNP:386518307
complement(581)-g, cdbSNP:199840128
complement(584)-t, cdbSNP:369649894
complement(590)-t, cdbSNP:369608212
complement(605)-, cdbSNP:371577379
complement(609)-g, adbSNP:375090196
complement(610)-t, cdbSNP:373081136
complement(641)-g, adbSNP:200788986
complement(645)-c, adbSNP:141460657
complement(656)-t, cdbSNP:183700327
complement(668)-g, adbSNP:199768496
complement(747)-dbSNP:
complement(747)-g, c, adbSNP:200639498
complement(802)-g, cdbSNP:372682991
complement(803)-c, adbSNP:191544901
complement(812)-t, cdbSNP:148332231
complement(855)-dbSNP:
complement(855)-t, cdbSNP:386518309
855+c, tdbSNP:11465209
complement(871)-g, cdbSNP:199968990
complement(900)-t, cdbSNP:1611772
complement(903)-g, adbSNP:369597551
complement(904)-t, cdbSNP:139043100
complement(973)-t, cdbSNP:1611773
complement(1091)-g, adbSNP:11465210
complement(1091)-g, adbSNP:386518310
complement(1126)-t, adbSNP:188749315
complement(1160)-c, adbSNP:112893627
Gene SymbolMUC1
Gene SynonymADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM
Chromosome1
Locus Map1q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001204288 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 12, mRNA. On-demand $399.00 14
NM_001204296 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 20, mRNA. On-demand $399.00 14
NM_001204297 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 21, mRNA. On-demand $399.00 14
NM_001204287 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 11, mRNA. On-demand $449.00 14
NM_001018016 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 2, mRNA. In-stock $348.00 $299.00 10
NM_001204290 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 14, mRNA. On-demand $399.00 14
NM_001044391 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 6, mRNA. On-demand $299.00 14
NM_001204292 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 16, mRNA. On-demand $399.00 14
NM_001204286 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 10, mRNA. On-demand TBD TBD
NM_001204289 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 13, mRNA. On-demand $399.00 14
NM_001204291 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 15, mRNA. On-demand $399.00 14
NM_001204295 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 19, mRNA. On-demand $399.00 14
NM_001044393 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 8, mRNA. On-demand $399.00 14
NM_001044390 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 5, mRNA. On-demand $399.00 14
NM_001204293 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 17, mRNA. On-demand $399.00 14
NM_001018017 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 3, mRNA. On-demand $449.00 14
NM_001044392 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 7, mRNA. In-stock $308.00 $259.00 10
NM_001204294 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 18, mRNA. On-demand $399.00 14
NM_002456 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 1, mRNA. In-stock $348.00 $299.00 10
NM_001204285 Homo sapiens mucin 1, cell surface associated (MUC1), transcript variant 9, mRNA. On-demand TBD TBD
Title Genetic regulation of MUC1 expression by Helicobacter pylori in gastric cancer cells .
Author Guang W, Czinn SJ, Blanchard TG, Kim KC and Lillehoj EP.
Journal Biochem. Biophys. Res. Commun. 445 (1), 145-150 (2014)
Title A novel protein derived from the MUC1 gene by alternative splicing and frameshifting .
Author Levitin F, Baruch A, Weiss M, Stiegman K, Hartmann ML, Yoeli-Lerner M, Ziv R, Zrihan-Licht S, Shina S, Gat A, Lifschitz B, Simha M, Stadler Y, Cholostoy A, Gil B, Greaves D, Keydar I, Zaretsky J, Smorodinsky N and Wreschner DH.
Journal J. Biol. Chem. 280 (11), 10655-10663 (2005)
Title Identification of MUC1 proteolytic cleavage sites in vivo .
Author Parry S, Silverman HS, McDermott K, Willis A, Hollingsworth MA and Harris A.
Journal Biochem. Biophys. Res. Commun. 283 (3), 715-720 (2001)
Title Characterization and molecular cloning of a novel MUC1 protein, devoid of tandem repeats, expressed in human breast cancer tissue .
Author Zrihan-Licht S, Vos HL, Baruch A, Elroy-Stein O, Sagiv D, Keydar I, Hilkens J and Wreschner DH.
Journal Eur. J. Biochem. 224 (2), 787-795 (1994)
Title Medullary Cystic Kidney Disease Type 1 .
Author Bleyer,A.J. and Kmoch,S.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Structure and expression of the human polymorphic epithelial mucin gene: an expressed VNTR unit .
Author Lancaster CA, Peat N, Duhig T, Wilson D, Taylor-Papadimitriou J and Gendler SJ.
Journal Biochem. Biophys. Res. Commun. 173 (3), 1019-1029 (1990)
Title Isolation and characterization of an expressed hypervariable gene coding for a breast-cancer-associated antigen .
Author Tsarfaty I, Hareuveni M, Horev J, Zaretsky J, Weiss M, Jeltsch JM, Garnier JM, Lathe R, Keydar I and Wreschner DH.
Journal Gene 93 (2), 313-318 (1990)
Title Cloning and sequencing of a human pancreatic tumor mucin cDNA .
Author Lan MS, Batra SK, Qi WN, Metzgar RS and Hollingsworth MA.
Journal J. Biol. Chem. 265 (25), 15294-15299 (1990)
Title Molecular cloning and expression of human tumor-associated polymorphic epithelial mucin .
Author Gendler SJ, Lancaster CA, Taylor-Papadimitriou J, Duhig T, Peat N, Burchell J, Pemberton L, Lalani EN and Wilson D.
Journal J. Biol. Chem. 265 (25), 15286-15293 (1990)
Title Episialin, a carcinoma-associated mucin, is generated by a polymorphic gene encoding splice variants with alternative amino termini .
Author Ligtenberg MJ, Vos HL, Gennissen AM and Hilkens J.
Journal J. Biol. Chem. 265 (10), 5573-5578 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.