• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002471 Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), mRNA. GenEZ ORF Cloning On-demand $2699.00 30

*Business Day

Related Services

RefSeq Version NM_002471.3, 289803014
Length 5941 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), mRNA.
Product myosin-6
Comment

Summary: Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3. [provided by RefSeq, Mar 2010].

RefSeq NP_002462.2
CDS 72..5891
Misc Feature(1)171..296
Misc Feature(2)171..296
Misc Feature(3)309..2411
Misc Feature(4)312..2408
Misc Feature(5)order(447..458,462..467,609..632)
Misc Feature(6)792..809
Misc Feature(7)1458..1481
Misc Feature(8)order(1542..1577,1584..1613)
Misc Feature(9)2040..2108
Misc Feature(10)2160..2204
Misc Feature(11)order(2199..2204,2211..2213,2229..2231,2238..2243,
Misc Feature(12)2346..2390
Misc Feature(13)5112..5480
Exon (1)1..25
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (2)26..58
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (3)59..272
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (4)273..416
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (5)417..573
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (6)574..601
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (7)602..713
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (8)714..806
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (9)807..870
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (10)871..969
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (11)970..1073
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (12)1074..1212
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (13)1213..1481
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (14)1482..1652
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (15)1653..1962
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (16)1963..2033
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (17)2034..2121
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (18)2122..2239
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (19)2240..2363
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (20)2364..2500
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (21)2501..2756
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (22)2757..2999
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (23)3000..3176
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (24)3177..3322
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (25)3323..3413
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (26)3414..3803
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (27)3804..3930
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (28)3931..4049
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (29)4050..4246
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (30)4247..4430
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (31)4431..4596
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (32)4597..4721
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (33)4722..5030
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (34)5031..5234
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (35)5235..5360
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (36)5361..5636
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (37)5637..5732
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (38)5733..5867
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (39)5868..5941
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Translation MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKILSREGGKVI AETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGL FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES GAGKTVNTKRVIQYFASIAAIGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRND NSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLD MLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTSEEKAGVYKLTGAIMHY GNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQ VYYSIGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCIN FTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECM FPKATDMTFKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLIHYAGTVDYNILGWLEKNKD PLNETVVALYQKSSLKLMATLFSSYATADTGDSGKSKGGKKKGSSFQTVSALHRENLNKL MTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF RQRYRILNPVAIPEGQFIDSRKGTEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRD ERLSRIITRMQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKP LLKSAETEKEMATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNL NDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLE LTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQVEEDKVN SLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEE KLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSD LSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHAD SVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANE YRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQ LEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETD AIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAA AAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETF KRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKI LRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAETRSRNEVLRVKKKM EGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRN NLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQ SEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLD EAEQIALKGGKKQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIKELTYQTEEDK KNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVN KLRAKSRDIGAKQKMHDEE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(8)-dbSNP:
complement(8)-g, cdbSNP:79618123
complement(10)-t, cdbSNP:190479390
complement(59)-dbSNP:
complement(59)-t, cdbSNP:201850118
complement(64)-g, adbSNP:28730779
complement(67)-t, gdbSNP:183611755
complement(70)-t, gdbSNP:143563109
complement(107)-t, cdbSNP:141014719
complement(157)-t, cdbSNP:150574114
complement(164)-c, adbSNP:200657398
complement(186)-t, cdbSNP:142850511
complement(192)-t, cdbSNP:201161721
complement(237)-t, cdbSNP:28711516
complement(281)-dbSNP:
complement(281)-g, adbSNP:147397431
complement(333)-g, cdbSNP:442275
complement(362)-g, adbSNP:144535842
complement(363)-t, cdbSNP:140596256
complement(371)-t, cdbSNP:200520512
complement(398)-g, adbSNP:147148031
complement(400)-g, adbSNP:149454728
complement(401)-t, cdbSNP:77679218
complement(410)-c, adbSNP:150745354
complement(464)-dbSNP:
complement(464)-t, cdbSNP:17277970
complement(470)-t, cdbSNP:78891557
complement(479)-g, adbSNP:140732380
complement(482)-t, cdbSNP:2277474
complement(491)-g, adbSNP:145023897
complement(498)-t, gdbSNP:2277473
complement(499)-t, cdbSNP:200377640
complement(502)-c, adbSNP:199923533
complement(521)-g, adbSNP:200162237
complement(563)-g, adbSNP:201380776
complement(573)-g, cdbSNP:145149045
complement(617)-dbSNP:
complement(617)-t, cdbSNP:150015506
complement(682)-t, cdbSNP:200623022
complement(693)-t, cdbSNP:142027794
complement(707)-t, cdbSNP:111265123
complement(749)-dbSNP:
complement(749)-g, adbSNP:147833723
complement(750)-t, cdbSNP:201828188
complement(762)-g, adbSNP:199916773
complement(788)-g, adbSNP:201599891
complement(794)-g, adbSNP:144387990
complement(802)-t, cdbSNP:200645920
complement(821)-dbSNP:
complement(821)-t, cdbSNP:201334814
complement(881)-dbSNP:
complement(881)-t, cdbSNP:178646
complement(895)-t, adbSNP:201327273
complement(902)-c, adbSNP:140660481
complement(914)-t, cdbSNP:112735414
complement(935)-g, cdbSNP:186265521
complement(956)-t, cdbSNP:147220875
complement(980)-dbSNP:
complement(980)-t, cdbSNP:17091623
complement(986)-g, adbSNP:113418220
complement(1052)-g, adbSNP:148407931
complement(1053)-t, cdbSNP:144422878
complement(1064)-t, cdbSNP:112677696
complement(1070)-g, adbSNP:78107039
complement(1078)-dbSNP:
complement(1078)-g, cdbSNP:138572790
complement(1119)-t, cdbSNP:200260629
complement(1132)-g, adbSNP:201375441
complement(1136)-t, gdbSNP:146378270
complement(1142)-g, adbSNP:58131640
complement(1154)-c, adbSNP:138928022
complement(1158)-t, adbSNP:202196487
complement(1159)-g, adbSNP:150272218
complement(1180)-t, cdbSNP:141083503
complement(1193)-t, cdbSNP:148091079
complement(1198)-c, adbSNP:2515926
complement(1199)-c, adbSNP:2516353
complement(1202)-g, c, adbSNP:61742472
complement(1203)-t, cdbSNP:148962966
complement(1226)-dbSNP:
complement(1226)-t, c, adbSNP:147903010
complement(1227)-t, cdbSNP:146468868
complement(1229)-g, adbSNP:142169847
complement(1248)-c, adbSNP:199877580
complement(1256)-g, cdbSNP:201822160
complement(1320)-t, cdbSNP:199754151
complement(1323)-t, cdbSNP:147606900
complement(1332)-t, cdbSNP:200359124
complement(1346)-g, adbSNP:61742470
complement(1347)-t, cdbSNP:139191436
complement(1398)-g, adbSNP:182373896
complement(1399)-t, cdbSNP:202096001
complement(1406)-g, adbSNP:61731179
complement(1418)-c, adbSNP:142059069
complement(1423)-t, cdbSNP:112494241
complement(1481)-g, adbSNP:139886074
complement(1520)-dbSNP:
complement(1520)-g, adbSNP:145447555
complement(1556)-g, adbSNP:181613656
complement(1591)-g, adbSNP:188023690
complement(1592)-c, adbSNP:142410102
complement(1610)-g, adbSNP:140141391
complement(1616)-g, adbSNP:200235378
complement(1772)-dbSNP:
complement(1772)-t, cdbSNP:202122530
complement(1773)-g, adbSNP:149650190
complement(1788)-t, cdbSNP:201040801
complement(1820)-g, adbSNP:187508349
complement(1821)-t, cdbSNP:138317414
complement(1824)-t, cdbSNP:150415679
complement(1834)-t, gdbSNP:142992009
complement(1850)-t, gdbSNP:190996339
complement(1867)-t, adbSNP:201855741
complement(1880)-g, adbSNP:186134696
complement(1910)-g, cdbSNP:138984258
complement(1934)-g, adbSNP:201043980
complement(1946)-g, adbSNP:146591697
complement(1950)-t, gdbSNP:80337928
complement(1956)-t, cdbSNP:180904654
complement(2006)-dbSNP:
complement(2006)-g, adbSNP:142393002
complement(2029)-t, gdbSNP:201219066
complement(2045)-dbSNP:
complement(2045)-t, gdbSNP:147623358
complement(2060)-t, cdbSNP:28730774
complement(2142)-dbSNP:
complement(2142)-t, cdbSNP:148915045
complement(2159)-g, adbSNP:145613682
complement(2168)-g, adbSNP:149734381
complement(2222)-g, adbSNP:76202964
complement(2255)-dbSNP:
complement(2255)-g, adbSNP:200813340
complement(2277)-t, gdbSNP:201411075
complement(2293)-g, cdbSNP:146414756
complement(2321)-g, adbSNP:144050960
complement(2377)-dbSNP:
complement(2377)-g, adbSNP:139182991
complement(2406)-g, adbSNP:182951502
complement(2418)-t, gdbSNP:11847151
complement(2428)-t, adbSNP:200229373
complement(2436)-g, adbSNP:200925880
complement(2454)-g, adbSNP:202120238
2455+a, gdbSNP:267606907
complement(2468)-t, cdbSNP:199993769
complement(2472)-t, cdbSNP:75487328
complement(2511)-dbSNP:
complement(2511)-t, gdbSNP:150675144
complement(2519)-g, cdbSNP:199675944
2530+a, tdbSNP:267606903
complement(2535)-t, cdbSNP:138419275
complement(2554)-t, cdbSNP:200323611
2560+c, tdbSNP:267606906
complement(2591)-t, cdbSNP:141945051
complement(2635)-t, cdbSNP:200751191
complement(2645)-g, adbSNP:148596692
complement(2650)-t, cdbSNP:115845031
complement(2662)-g, adbSNP:200153625
complement(2671)-t, cdbSNP:143284278
complement(2674)-g, adbSNP:147015593
complement(2675)-g, adbSNP:139049534
complement(2685)-g, adbSNP:201193346
complement(2714)-g, adbSNP:146332977
complement(2777)-dbSNP:
complement(2777)-g, adbSNP:150539220
complement(2787)-g, adbSNP:143928061
complement(2809)-t, cdbSNP:138213182
complement(2877)-c, adbSNP:141704264
complement(2878)-g, adbSNP:199838024
complement(2900)-g, adbSNP:200324323
complement(2904)-g, adbSNP:441636
complement(2912)-g, adbSNP:140305424
complement(2917)-t, cdbSNP:148234492
complement(2961)-c, adbSNP:144907522
complement(2992)-t, cdbSNP:201602951
complement(3000)-dbSNP:
complement(3000)-g, cdbSNP:141079114
complement(3017)-t, cdbSNP:145274612
complement(3019)-t, cdbSNP:201008410
complement(3022)-g, adbSNP:202028680
complement(3063)-t, cdbSNP:112779419
complement(3080)-t, cdbSNP:199901927
complement(3081)-c, adbSNP:143978652
complement(3188)-dbSNP:
complement(3188)-g, adbSNP:140314752
3266+c, gdbSNP:267606904
complement(3270)-t, cdbSNP:145508517
complement(3305)-t, cdbSNP:149682518
complement(3306)-g, cdbSNP:139368987
complement(3360)-dbSNP:
complement(3360)-t, cdbSNP:150868324
complement(3368)-t, cdbSNP:144957142
complement(3372)-t, cdbSNP:140996984
complement(3373)-g, adbSNP:365990
complement(3374)-t, cdbSNP:143825034
complement(3459)-dbSNP:
complement(3459)-g, adbSNP:28730771
complement(3479)-g, adbSNP:28730770
complement(3618)-t, cdbSNP:111916361
complement(3680)-g, cdbSNP:149369904
complement(3698)-g, adbSNP:147871745
complement(3711)-t, gdbSNP:199911460
complement(3768)-t, cdbSNP:144761217
complement(3829)-dbSNP:
complement(3829)-g, adbSNP:201051663
complement(3888)-t, adbSNP:200503588
complement(3907)-t, cdbSNP:200014711
complement(3923)-g, adbSNP:141143152
complement(3938)-dbSNP:
complement(3938)-c, adbSNP:138127105
complement(3947)-t, cdbSNP:145290322
complement(3954)-g, cdbSNP:34935550
complement(3965)-t, cdbSNP:151135141
complement(3974)-t, cdbSNP:201804323
complement(3998)-g, adbSNP:115742584
complement(4051)-dbSNP:
complement(4051)-g, adbSNP:148558068
complement(4082)-g, adbSNP:451794
complement(4097)-t, g, adbSNP:141062252
complement(4142)-g, adbSNP:147328051
complement(4207)-g, adbSNP:145611185
complement(4211)-g, adbSNP:199672166
complement(4222)-t, cdbSNP:139265690
complement(4235)-g, adbSNP:201379347
complement(4264)-dbSNP:
complement(4264)-t, cdbSNP:150815925
complement(4277)-g, adbSNP:111638554
complement(4287)-t, cdbSNP:201566738
complement(4302)-t, cdbSNP:146172839
complement(4316)-t, cdbSNP:148319461
complement(4335)-g, adbSNP:200465713
complement(4363)-g, adbSNP:146015292
complement(4364)-t, cdbSNP:201016285
complement(4378)-t, cdbSNP:142556730
complement(4385)-t, cdbSNP:434030
complement(4388)-t, cdbSNP:434041
complement(4389)-g, cdbSNP:137983703
complement(4391)-t, adbSNP:145566711
complement(4396)-g, adbSNP:141534763
4440+dbSNP:
4440+a, gdbSNP:267606905
complement(4457)-g, adbSNP:149314355
complement(4463)-t, cdbSNP:141811321
complement(4466)-t, cdbSNP:74039310
complement(4472)-c, adbSNP:150081280
complement(4487)-t, cdbSNP:140800076
complement(4496)-t, cdbSNP:200273813
complement(4500)-g, adbSNP:201989347
complement(4501)-t, cdbSNP:147586142
complement(4550)-g, adbSNP:201830842
complement(4576)-t, cdbSNP:199936506
complement(4584)-t, cdbSNP:199796162
complement(4596)-c, adbSNP:200380187
complement(4598)-dbSNP:
complement(4598)-g, adbSNP:34855944
complement(4607)-t, cdbSNP:142539180
complement(4613)-g, adbSNP:200288559
complement(4631)-t, cdbSNP:200918670
complement(4665)-g, adbSNP:201827489
complement(4666)-t, gdbSNP:34330111
complement(4673)-g, cdbSNP:199600772
complement(4682)-t, cdbSNP:142983918
complement(4686)-t, gdbSNP:199881235
complement(4737)-dbSNP:
complement(4737)-t, cdbSNP:148582147
complement(4746)-t, adbSNP:145724064
complement(4775)-t, gdbSNP:149771264
complement(4792)-t, adbSNP:199627411
complement(4843)-t, cdbSNP:200751434
complement(4849)-t, adbSNP:45574136
complement(4852)-t, cdbSNP:146095234
complement(4853)-t, cdbSNP:142823394
complement(4855)-g, adbSNP:201026560
complement(4883)-g, adbSNP:201667127
complement(4893)-g, adbSNP:201683868
complement(4904)-g, adbSNP:139329956
complement(4909)-g, adbSNP:61742476
complement(4921)-t, gdbSNP:141375292
complement(4970)-g, adbSNP:61742474
complement(4976)-g, adbSNP:143048583
complement(4977)-g, adbSNP:149460065
complement(4985)-g, adbSNP:178640
complement(5051)-dbSNP:
complement(5051)-t, cdbSNP:382872
complement(5057)-t, cdbSNP:77416370
complement(5058)-t, cdbSNP:200295909
complement(5073)-t, cdbSNP:200884672
complement(5104)-t, cdbSNP:141195890
complement(5110)-t, adbSNP:147728632
complement(5138)-t, cdbSNP:202210008
complement(5183)-t, cdbSNP:150450178
complement(5206)-c, adbSNP:201383498
complement(5211)-t, g, adbSNP:140651265
complement(5272)-dbSNP:
complement(5272)-g, adbSNP:151324358
complement(5273)-t, gdbSNP:1059853
complement(5276)-t, cdbSNP:3179266
complement(5280)-t, adbSNP:1059854
complement(5328)-g, cdbSNP:142437308
complement(5330)-g, adbSNP:8004990
complement(5349)-t, cdbSNP:146539406
complement(5355)-t, cdbSNP:200972499
complement(5471)-dbSNP:
complement(5471)-g, adbSNP:144329079
complement(5474)-t, cdbSNP:139597048
complement(5481)-t, gdbSNP:144571463
complement(5498)-t, gdbSNP:149294569
complement(5510)-t, cdbSNP:200854143
complement(5523)-g, cdbSNP:201494081
complement(5529)-g, adbSNP:111473291
complement(5535)-g, cdbSNP:150589765
complement(5546)-t, cdbSNP:79143968
complement(5547)-t, cdbSNP:202141059
complement(5548)-t, cdbSNP:200260229
complement(5561)-g, adbSNP:201209864
complement(5571)-g, adbSNP:137923514
complement(5572)-t, cdbSNP:202132499
complement(5579)-g, adbSNP:193922654
complement(5615)-g, adbSNP:147348589
complement(5658)-dbSNP:
complement(5658)-g, adbSNP:142767538
complement(5665)-t, cdbSNP:138720701
complement(5669)-t, cdbSNP:17091278
complement(5672)-t, cdbSNP:148984154
complement(5698)-t, cdbSNP:201919534
complement(5712)-t, adbSNP:201552605
complement(5716)-t, cdbSNP:199755234
complement(5723)-g, adbSNP:200662317
complement(5727)-t, cdbSNP:138864419
complement(5765)-g, cdbSNP:201199853
complement(5767)-t, cdbSNP:61731171
complement(5807)-t, cdbSNP:150277296
complement(5896)-dbSNP:
complement(5896)-c, adbSNP:139102144
complement(5899)-g, adbSNP:201560522
Gene SymbolMYH6
Gene Synonymalpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Chromosome14
Locus Map14q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002471 Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), mRNA. On-demand $2699.00 30
Title MYH9-related disorders: report on a patient of Greek origin presenting with macroscopic hematuria and presenile cataract, caused by an R1165C mutation .
Author Economou,M., Batzios,S.P., Pecci,A., Printza,N., Savoia,A., Barozzi,S., Theodoridou,S., Teli,A., Psillas,G. and Zafeiriou,D.I.
Journal J. Pediatr. Hematol. Oncol. 34 (6), 412-415 (2012)
Title Impaired thymic tolerance to alpha-myosin directs autoimmunity to the heart in mice and humans .
Author Lv,H., Havari,E., Pinto,S., Gottumukkala,R.V., Cornivelli,L., Raddassi,K., Matsui,T., Rosenzweig,A., Bronson,R.T., Smith,R., Fletcher,A.L., Turley,S.J., Wucherpfennig,K., Kyewski,B. and Lipes,M.A.
Journal J. Clin. Invest. 121 (4), 1561-1573 (2011)
Title A rare variant in MYH6 is associated with high risk of sick sinus syndrome .
Author Holm,H., Gudbjartsson,D.F., Sulem,P., Masson,G., Helgadottir,H.T., Zanon,C., Magnusson,O.T., Helgason,A., Saemundsdottir,J., Gylfason,A., Stefansdottir,H., Gretarsdottir,S., Matthiasson,S.E., Thorgeirsson,G.M., Jonasdottir,A., Sigurdsson,A., Stefansson,H., Werge,T., Rafnar,T., Kiemeney,L.A., Parvez,B., Muhammad,R., Roden,D.M., Darbar,D., Thorleifsson,G., Walters,G.B., Kong,A., Thorsteinsdottir,U., Arnar,D.O. and Stefansson,K.
Journal Nat. Genet. 43 (4), 316-320 (2011)
Title Cardiac alpha-myosin (MYH6) is the predominant sarcomeric disease gene for familial atrial septal defects .
Author Posch,M.G., Waldmuller,S., Muller,M., Scheffold,T., Fournier,D., Andrade-Navarro,M.A., De Geeter,B., Guillaumont,S., Dauphin,C., Yousseff,D., Schmitt,K.R., Perrot,A., Berger,F., Hetzer,R., Bouvagnet,P. and Ozcelik,C.
Journal PLoS ONE 6 (12), E28872 (2011)
Title Alpha-cardiac myosin heavy chain (MYH6) mutations affecting myofibril formation are associated with congenital heart defects .
Author Granados-Riveron,J.T., Ghosh,T.K., Pope,M., Bu'Lock,F., Thornborough,C., Eason,J., Kirk,E.P., Fatkin,D., Feneley,M.P., Harvey,R.P., Armour,J.A. and David Brook,J.
Journal Hum. Mol. Genet. 19 (20), 4007-4016 (2010)
Title Complete sequence of human cardiac alpha-myosin heavy chain gene and amino acid comparison to other myosins based on structural and functional differences .
Author Matsuoka,R., Beisel,K.W., Furutani,M., Arai,S. and Takao,A.
Journal Am. J. Med. Genet. 41 (4), 537-547 (1991)
Title Determination of the 5' exon structure of the human cardiac alpha-myosin heavy chain gene .
Author Brand,N.J., Dabhade,N., Yacoub,M. and Barton,P.J.
Journal Biochem. Biophys. Res. Commun. 179 (3), 1255-1258 (1991)
Title Nucleotide sequence of chimpanzee Fc and hinge regions .
Author Ehrlich,P.H., Moustafa,Z.A. and Ostberg,L.
Journal Mol. Immunol. 28 (4-5), 319-322 (1991)
Title A molecular basis for familial hypertrophic cardiomyopathy: an alpha/beta cardiac myosin heavy chain hybrid gene .
Author Tanigawa,G., Jarcho,J.A., Kass,S., Solomon,S.D., Vosberg,H.P., Seidman,J.G. and Seidman,C.E.
Journal Cell 62 (5), 991-998 (1990)
Title A locus for familial hypertrophic cardiomyopathy is closely linked to the cardiac myosin heavy chain genes, CRI-L436, and CRI-L329 on chromosome 14 at q11-q12 .
Author Solomon,S.D., Geisterfer-Lowrance,A.A., Vosberg,H.P., Hiller,G., Jarcho,J.A., Morton,C.C., McBride,W.O., Mitchell,A.L., Bale,A.E., McKenna,W.J. et al.
Journal Am. J. Hum. Genet. 47 (3), 389-394 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.