• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002471 Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), mRNA. GenEZ ORF Cloning On-demand $2699.00 30

*Business Day

Related Services

RefSeq Version NM_002471.3, 289803014
Length 5941 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), mRNA.
Product myosin-6
Comment

Summary: Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3. [provided by RefSeq, Mar 2010].

RefSeq NP_002462.2
CDS 72..5891
Misc Feature(1)171..296
Misc Feature(2)171..296
Misc Feature(3)255..2534
Misc Feature(4)312..2408
Misc Feature(5)order(447..458,462..467,609..632)
Misc Feature(6)792..809
Misc Feature(7)1458..1481
Misc Feature(8)order(1542..1577,1584..1613)
Misc Feature(9)2040..2108
Misc Feature(10)2160..2204
Misc Feature(11)order(2199..2204,2211..2213,2229..2231,2238..2243,
Misc Feature(12)2346..2390
Misc Feature(13)2616..3206
Misc Feature(14)2712..3200
Misc Feature(15)3279..5855
Misc Feature(16)<3471..3956
Misc Feature(17)<3960..>4298
Misc Feature(18)order(3960..3962,3972..3974,3981..3986,3993..3995,
Misc Feature(19)5112..5480
Exon (1)1..25
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (2)26..58
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (3)59..272
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (4)273..416
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (5)417..573
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (6)574..601
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (7)602..713
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (8)714..806
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (9)807..870
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (10)871..969
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (11)970..1073
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (12)1074..1212
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (13)1213..1481
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (14)1482..1652
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (15)1653..1962
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (16)1963..2033
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (17)2034..2121
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (18)2122..2239
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (19)2240..2363
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (20)2364..2500
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (21)2501..2756
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (22)2757..2999
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (23)3000..3176
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (24)3177..3322
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (25)3323..3413
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (26)3414..3803
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (27)3804..3930
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (28)3931..4049
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (29)4050..4246
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (30)4247..4430
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (31)4431..4596
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (32)4597..4721
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (33)4722..5030
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (34)5031..5234
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (35)5235..5360
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (36)5361..5636
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (37)5637..5732
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (38)5733..5867
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Exon (39)5868..5941
Gene:MYH6
Gene Synonym:alpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Translation MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKILSREGGKVI AETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGL FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES GAGKTVNTKRVIQYFASIAAIGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRND NSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLD MLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTSEEKAGVYKLTGAIMHY GNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQ VYYSIGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCIN FTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECM FPKATDMTFKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLIHYAGTVDYNILGWLEKNKD PLNETVVALYQKSSLKLMATLFSSYATADTGDSGKSKGGKKKGSSFQTVSALHRENLNKL MTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF RQRYRILNPVAIPEGQFIDSRKGTEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRD ERLSRIITRMQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKP LLKSAETEKEMATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNL NDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLE LTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQVEEDKVN SLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEE KLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSD LSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHAD SVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANE YRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQ LEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETD AIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAA AAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETF KRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKI LRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAETRSRNEVLRVKKKM EGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRN NLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQ SEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLD EAEQIALKGGKKQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIKELTYQTEEDK KNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVN KLRAKSRDIGAKQKMHDEE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(8)-dbSNP:
complement(8)-g, cdbSNP:79618123
complement(10)-t, cdbSNP:190479390
complement(59)-dbSNP:
complement(59)-t, cdbSNP:201850118
64+a, gdbSNP:28730779
complement(67)-t, gdbSNP:183611755
complement(70)-t, gdbSNP:143563109
complement(78)-t, cdbSNP:371667049
complement(107)-t, cdbSNP:141014719
complement(157)-t, cdbSNP:150574114
complement(164)-c, adbSNP:200657398
complement(186)-t, cdbSNP:142850511
complement(192)-t, cdbSNP:201161721
complement(231)-g, adbSNP:369366244
complement(237)-t, cdbSNP:28711516
complement(246)-g, cdbSNP:377029781
complement(281)-dbSNP:
complement(281)-g, adbSNP:147397431
323+c, tdbSNP:397516757
324+a, gdbSNP:397516758
complement(333)-g, cdbSNP:442275
complement(362)-g, adbSNP:144535842
complement(363)-t, cdbSNP:140596256
complement(371)-t, cdbSNP:200520512
complement(379)-c, adbSNP:376330318
complement(398)-g, adbSNP:147148031
399+a, gdbSNP:397516760
complement(400)-g, adbSNP:149454728
complement(401)-t, cdbSNP:77679218
complement(410)-c, adbSNP:150745354
complement(425)-dbSNP:
complement(425)-t, cdbSNP:373427673
complement(464)-t, cdbSNP:17277970
complement(467)-t, cdbSNP:369139462
complement(470)-t, cdbSNP:78891557
complement(479)-g, adbSNP:140732380
complement(482)-t, cdbSNP:2277474
complement(491)-g, adbSNP:145023897
complement(498)-t, gdbSNP:2277473
complement(499)-t, cdbSNP:200377640
complement(502)-c, adbSNP:199923533
complement(511)-t, cdbSNP:377104438
complement(521)-g, adbSNP:200162237
complement(538)-g, cdbSNP:372298082
complement(546)-t, cdbSNP:369931610
556+a, gdbSNP:397516772
complement(563)-g, adbSNP:201380776
complement(573)-g, cdbSNP:145149045
complement(617)-dbSNP:
complement(617)-t, cdbSNP:150015506
639+c, tdbSNP:397516777
complement(682)-t, cdbSNP:200623022
complement(693)-t, cdbSNP:142027794
complement(707)-t, cdbSNP:111265123
complement(750)-dbSNP:
complement(750)-t, cdbSNP:201828188
complement(762)-g, adbSNP:199916773
complement(788)-g, adbSNP:201599891
complement(789)-t, cdbSNP:375030177
complement(794)-g, adbSNP:144387990
complement(802)-t, cdbSNP:200645920
803+c, tdbSNP:397516779
complement(805)-g, adbSNP:371608354
complement(821)-dbSNP:
complement(821)-t, cdbSNP:201334814
complement(881)-dbSNP:
complement(881)-t, cdbSNP:178646
complement(895)-t, adbSNP:201327273
complement(902)-c, adbSNP:140660481
complement(914)-t, cdbSNP:112735414
complement(935)-g, cdbSNP:186265521
complement(956)-t, cdbSNP:147220875
complement(980)-dbSNP:
complement(980)-t, cdbSNP:17091623
complement(986)-g, adbSNP:113418220
complement(999)-t, cdbSNP:374692396
complement(1004)-g, adbSNP:371728824
complement(1010)-g, adbSNP:372589578
complement(1012)-g, adbSNP:367952105
complement(1031)-g, adbSNP:376547858
complement(1052)-g, adbSNP:148407931
complement(1053)-t, cdbSNP:144422878
complement(1064)-t, cdbSNP:112677696
complement(1070)-g, adbSNP:78107039
complement(1073)-t, adbSNP:371859345
complement(1078)-dbSNP:
complement(1078)-g, cdbSNP:138572790
complement(1118)-g, adbSNP:370709048
complement(1119)-t, cdbSNP:200260629
complement(1132)-g, adbSNP:201375441
complement(1142)-g, adbSNP:58131640
complement(1154)-c, adbSNP:138928022
complement(1157)-g, adbSNP:375189593
complement(1158)-t, adbSNP:202196487
complement(1159)-g, adbSNP:150272218
complement(1180)-t, cdbSNP:141083503
1183+a, gdbSNP:397516754
complement(1193)-t, cdbSNP:148091079
1198+a, cdbSNP:2515926
1199+a, cdbSNP:2516353
complement(1202)-g, c, adbSNP:61742472
complement(1203)-t, cdbSNP:148962966
complement(1208)-g, adbSNP:370917581
complement(1226)-dbSNP:
complement(1226)-t, c, adbSNP:147903010
complement(1227)-t, cdbSNP:146468868
complement(1229)-g, adbSNP:142169847
complement(1248)-c, adbSNP:199877580
complement(1256)-g, cdbSNP:201822160
complement(1320)-t, cdbSNP:199754151
complement(1323)-t, cdbSNP:147606900
complement(1332)-t, cdbSNP:200359124
complement(1346)-g, adbSNP:61742470
complement(1347)-t, cdbSNP:139191436
complement(1387)-t, cdbSNP:375729555
complement(1398)-g, adbSNP:182373896
complement(1399)-t, c, adbSNP:202096001
complement(1406)-g, adbSNP:61731179
complement(1418)-c, adbSNP:142059069
complement(1423)-t, cdbSNP:112494241
complement(1452)-g, adbSNP:368609214
complement(1481)-g, adbSNP:139886074
1496+dbSNP:
1496+c, gdbSNP:397516755
complement(1520)-g, adbSNP:145447555
complement(1556)-g, adbSNP:181613656
complement(1563)-t, cdbSNP:375142167
complement(1571)-g, cdbSNP:372073959
complement(1591)-g, adbSNP:188023690
complement(1592)-c, adbSNP:142410102
1606+c, tdbSNP:397516756
complement(1610)-g, adbSNP:140141391
complement(1616)-g, adbSNP:200235378
complement(1670)-dbSNP:
complement(1670)-g, adbSNP:371263768
complement(1699)-t, cdbSNP:367663906
complement(1733)-g, adbSNP:374114140
complement(1735)-t, cdbSNP:370663301
complement(1772)-t, cdbSNP:202122530
complement(1773)-g, adbSNP:149650190
complement(1774)-t, cdbSNP:376291577
complement(1788)-t, cdbSNP:201040801
complement(1807)-g, cdbSNP:374180605
complement(1812)-t, cdbSNP:371080062
complement(1820)-g, adbSNP:187508349
complement(1821)-t, cdbSNP:138317414
complement(1824)-t, cdbSNP:150415679
complement(1834)-t, gdbSNP:142992009
complement(1850)-t, gdbSNP:190996339
complement(1867)-t, adbSNP:201855741
complement(1880)-g, adbSNP:186134696
complement(1910)-g, cdbSNP:138984258
complement(1934)-g, adbSNP:201043980
complement(1946)-g, adbSNP:146591697
1950+g, tdbSNP:80337928
complement(1956)-t, cdbSNP:180904654
complement(1965)-dbSNP:
complement(1965)-t, cdbSNP:367607444
complement(2006)-g, adbSNP:142393002
complement(2015)-t, cdbSNP:367742240
complement(2020)-g, adbSNP:372300127
complement(2029)-t, gdbSNP:201219066
complement(2031)-t, gdbSNP:369938365
complement(2045)-dbSNP:
complement(2045)-t, gdbSNP:147623358
2060+c, tdbSNP:28730774
complement(2142)-dbSNP:
complement(2142)-t, cdbSNP:148915045
complement(2159)-g, adbSNP:145613682
complement(2168)-g, adbSNP:149734381
complement(2222)-g, adbSNP:76202964
2232+c, tdbSNP:387906656
complement(2247)-dbSNP:
complement(2247)-t, adbSNP:377485587
complement(2255)-g, adbSNP:200813340
complement(2277)-t, gdbSNP:201411075
complement(2288)-g, adbSNP:374177807
complement(2293)-g, cdbSNP:146414756
complement(2321)-g, adbSNP:144050960
complement(2329)-g, adbSNP:369729808
complement(2377)-dbSNP:
complement(2377)-g, adbSNP:139182991
complement(2406)-g, adbSNP:182951502
complement(2418)-t, gdbSNP:11847151
complement(2428)-t, adbSNP:200229373
complement(2436)-g, adbSNP:200925880
complement(2454)-g, adbSNP:202120238
2455+a, gdbSNP:267606907
complement(2468)-t, cdbSNP:199993769
complement(2472)-t, cdbSNP:75487328
complement(2511)-dbSNP:
complement(2511)-t, gdbSNP:150675144
complement(2519)-g, cdbSNP:199675944
2530+a, tdbSNP:267606903
complement(2535)-t, cdbSNP:138419275
complement(2549)-t, gdbSNP:369050841
complement(2554)-t, cdbSNP:200323611
2560+c, tdbSNP:267606906
complement(2591)-t, cdbSNP:141945051
complement(2624)-t, cdbSNP:373248520
complement(2635)-t, cdbSNP:200751191
complement(2645)-g, adbSNP:148596692
complement(2646)-t, cdbSNP:369274077
complement(2650)-t, cdbSNP:115845031
complement(2662)-g, adbSNP:200153625
2670+a, gdbSNP:397516759
complement(2671)-t, cdbSNP:143284278
complement(2674)-g, adbSNP:147015593
complement(2675)-g, adbSNP:139049534
complement(2682)-g, adbSNP:376682837
complement(2685)-g, adbSNP:201193346
complement(2714)-g, adbSNP:146332977
complement(2717)-t, cdbSNP:373950549
complement(2733)-t, cdbSNP:267603952
complement(2777)-dbSNP:
complement(2777)-g, adbSNP:150539220
complement(2787)-g, adbSNP:143928061
complement(2809)-t, cdbSNP:138213182
complement(2837)-t, cdbSNP:373721137
complement(2839)-t, gdbSNP:371709369
complement(2877)-c, adbSNP:141704264
complement(2878)-g, adbSNP:199838024
complement(2898)-g, cdbSNP:368912844
complement(2900)-g, adbSNP:200324323
complement(2904)-g, adbSNP:441636
complement(2912)-g, adbSNP:140305424
complement(2917)-t, cdbSNP:148234492
complement(2933)-c, adbSNP:375226438
complement(2934)-t, cdbSNP:267603951
complement(2961)-c, adbSNP:144907522
complement(2992)-t, cdbSNP:201602951
complement(3000)-dbSNP:
complement(3000)-g, cdbSNP:141079114
complement(3017)-t, cdbSNP:145274612
complement(3019)-t, cdbSNP:201008410
complement(3022)-g, adbSNP:202028680
complement(3036)-t, cdbSNP:369774403
complement(3044)-g, adbSNP:374807345
complement(3063)-t, cdbSNP:112779419
complement(3080)-t, cdbSNP:199901927
complement(3081)-c, adbSNP:143978652
complement(3144)-t, adbSNP:371209775
complement(3188)-dbSNP:
complement(3188)-g, adbSNP:140314752
complement(3189)-g, adbSNP:368497504
3266+c, gdbSNP:267606904
complement(3270)-t, cdbSNP:145508517
complement(3291)-t, cdbSNP:375169402
complement(3300)-g, adbSNP:371364790
complement(3301)-t, adbSNP:377716628
complement(3305)-t, cdbSNP:149682518
complement(3306)-g, cdbSNP:139368987
complement(3360)-dbSNP:
complement(3360)-t, cdbSNP:150868324
complement(3368)-t, cdbSNP:144957142
complement(3371)-g, cdbSNP:376802694
complement(3372)-t, cdbSNP:140996984
complement(3373)-g, adbSNP:365990
complement(3374)-t, cdbSNP:143825034
complement(3414)-dbSNP:
complement(3414)-t, cdbSNP:375733891
complement(3417)-g, adbSNP:372446459
complement(3418)-t, cdbSNP:369247906
complement(3454)-t, cdbSNP:376002621
complement(3459)-t, cdbSNP:61741930
complement(3459)-g, adbSNP:28730771
3479+a, gdbSNP:28730770
3508..3509+, adbSNP:397516761
complement(3551)-g, adbSNP:373345984
complement(3618)-t, cdbSNP:111916361
complement(3622)-g, adbSNP:112883817
complement(3666)-t, cdbSNP:369942086
complement(3669)-g, cdbSNP:372794975
complement(3675)-t, cdbSNP:368451573
complement(3680)-g, cdbSNP:149369904
3690+a, gdbSNP:397516762
complement(3698)-g, adbSNP:147871745
complement(3711)-t, gdbSNP:199911460
complement(3768)-t, cdbSNP:144761217
complement(3791)-t, gdbSNP:373081153
complement(3829)-dbSNP:
complement(3829)-g, adbSNP:201051663
3855+c, tdbSNP:397516763
complement(3858)-t, cdbSNP:375819633
complement(3879)-g, adbSNP:371849826
complement(3888)-t, adbSNP:200503588
complement(3907)-t, cdbSNP:200014711
complement(3923)-g, adbSNP:141143152
complement(3924)-t, cdbSNP:375655864
complement(3938)-dbSNP:
complement(3938)-c, adbSNP:138127105
complement(3947)-t, cdbSNP:145290322
complement(3954)-g, cdbSNP:34935550
complement(3964)-g, adbSNP:368588052
complement(3965)-t, cdbSNP:151135141
complement(3974)-t, cdbSNP:201804323
complement(3998)-g, adbSNP:115742584
complement(4051)-dbSNP:
complement(4051)-g, adbSNP:148558068
complement(4060)-g, adbSNP:369949768
complement(4061)-g, adbSNP:377302327
4082+a, gdbSNP:451794
complement(4097)-t, g, adbSNP:141062252
complement(4107)-g, adbSNP:372736126
4135+c, tdbSNP:397516767
complement(4142)-g, adbSNP:147328051
complement(4157)-g, cdbSNP:367788166
complement(4175)-t, cdbSNP:374887637
complement(4207)-g, adbSNP:145611185
complement(4208)-t, cdbSNP:372158844
complement(4211)-g, adbSNP:199672166
complement(4222)-t, cdbSNP:139265690
complement(4235)-g, adbSNP:201379347
4236+a, gdbSNP:397516768
complement(4240)-t, adbSNP:370600272
complement(4263)-dbSNP:
complement(4263)-g, adbSNP:374022661
complement(4264)-t, cdbSNP:150815925
complement(4277)-g, adbSNP:111638554
complement(4287)-t, cdbSNP:201566738
complement(4302)-t, cdbSNP:146172839
complement(4335)-g, adbSNP:200465713
complement(4363)-g, adbSNP:146015292
complement(4364)-t, cdbSNP:201016285
4371+a, gdbSNP:397516769
complement(4378)-t, cdbSNP:142556730
4385+c, tdbSNP:434030
4388+c, tdbSNP:434041
complement(4389)-g, cdbSNP:137983703
complement(4391)-t, adbSNP:145566711
complement(4396)-g, adbSNP:141534763
4440+dbSNP:
4440+a, gdbSNP:267606905
complement(4457)-g, adbSNP:149314355
complement(4460)-t, cdbSNP:368065780
complement(4461)-c, adbSNP:373897096
complement(4462)-t, gdbSNP:370412856
complement(4463)-t, cdbSNP:141811321
complement(4466)-t, cdbSNP:74039310
complement(4472)-c, adbSNP:150081280
complement(4487)-t, cdbSNP:140800076
complement(4496)-t, cdbSNP:200273813
complement(4500)-g, adbSNP:201989347
complement(4501)-t, cdbSNP:147586142
complement(4526)-t, cdbSNP:376316942
complement(4535)-g, adbSNP:376781285
complement(4550)-g, adbSNP:201830842
complement(4556)-t, cdbSNP:371206743
complement(4576)-t, cdbSNP:199936506
complement(4582)-t, cdbSNP:372671573
complement(4584)-t, cdbSNP:199796162
complement(4596)-c, adbSNP:200380187
complement(4598)-dbSNP:
complement(4598)-g, adbSNP:34855944
complement(4607)-t, cdbSNP:142539180
complement(4613)-g, adbSNP:200288559
complement(4631)-t, cdbSNP:200918670
complement(4656)-t, cdbSNP:372327939
complement(4665)-g, adbSNP:201827489
complement(4666)-t, gdbSNP:34330111
complement(4673)-g, cdbSNP:199600772
complement(4682)-t, cdbSNP:142983918
complement(4686)-t, gdbSNP:199881235
complement(4736)-dbSNP:
complement(4736)-g, adbSNP:373888186
complement(4737)-t, cdbSNP:148582147
complement(4746)-t, adbSNP:145724064
complement(4756)-c, adbSNP:371068881
complement(4766)-t, cdbSNP:374702183
complement(4775)-t, gdbSNP:149771264
complement(4792)-t, adbSNP:199627411
complement(4793)-g, adbSNP:375410722
complement(4794)-t, cdbSNP:371067114
4818+a, gdbSNP:397516771
complement(4840)-t, cdbSNP:377473560
complement(4843)-t, cdbSNP:200751434
complement(4849)-t, adbSNP:45574136
complement(4852)-t, cdbSNP:146095234
complement(4853)-t, cdbSNP:142823394
complement(4855)-g, adbSNP:201026560
complement(4883)-g, adbSNP:201667127
complement(4893)-g, adbSNP:201683868
complement(4904)-g, adbSNP:139329956
complement(4909)-g, adbSNP:61742476
complement(4917)-t, cdbSNP:372923261
complement(4921)-t, gdbSNP:141375292
complement(4970)-g, adbSNP:61742474
complement(4971)-t, cdbSNP:369767936
complement(4976)-g, adbSNP:143048583
complement(4977)-g, adbSNP:149460065
complement(4985)-g, adbSNP:178640
5051+dbSNP:
5051+c, tdbSNP:382872
complement(5057)-t, cdbSNP:77416370
complement(5058)-t, cdbSNP:200295909
complement(5064)-t, cdbSNP:374271404
complement(5069)-g, adbSNP:371361552
complement(5072)-g, adbSNP:377698958
complement(5073)-t, cdbSNP:200884672
5090+c, tdbSNP:397516773
complement(5104)-t, cdbSNP:141195890
complement(5110)-t, adbSNP:147728632
complement(5138)-t, cdbSNP:202210008
complement(5139)-g, adbSNP:370121893
complement(5147)-g, adbSNP:377569988
complement(5148)-t, cdbSNP:373457153
complement(5183)-t, cdbSNP:150450178
complement(5206)-c, adbSNP:201383498
5207+c, tdbSNP:397516774
complement(5208)-t, cdbSNP:369275573
complement(5211)-t, g, adbSNP:140651265
complement(5260)-dbSNP:
complement(5260)-t, cdbSNP:375346484
complement(5272)-g, adbSNP:151324358
5273+a, g, tdbSNP:1059853
5276+c, tdbSNP:3179266
5280+a, tdbSNP:1059854
complement(5294)-t, cdbSNP:368828361
complement(5328)-g, cdbSNP:142437308
complement(5330)-g, adbSNP:8004990
complement(5331)-c, adbSNP:372270600
complement(5349)-t, cdbSNP:146539406
complement(5355)-t, cdbSNP:200972499
5364+dbSNP:
5364+a, gdbSNP:397516775
5367+a, gdbSNP:397516776
complement(5379)-t, cdbSNP:369336248
complement(5468)-t, cdbSNP:375555473
complement(5471)-g, adbSNP:144329079
complement(5481)-t, gdbSNP:144571463
complement(5498)-t, gdbSNP:149294569
complement(5508)-g, cdbSNP:368384248
complement(5510)-t, cdbSNP:200854143
complement(5523)-g, cdbSNP:201494081
complement(5529)-g, adbSNP:111473291
complement(5530)-t, cdbSNP:371222772
complement(5535)-g, cdbSNP:150589765
complement(5546)-t, cdbSNP:79143968
complement(5547)-t, cdbSNP:202141059
complement(5548)-t, cdbSNP:200260229
complement(5561)-g, adbSNP:201209864
complement(5562)-t, cdbSNP:367834703
complement(5571)-g, adbSNP:137923514
complement(5572)-t, cdbSNP:202132499
5579+a, gdbSNP:193922654
complement(5590)-t, cdbSNP:373629059
complement(5615)-g, adbSNP:147348589
complement(5618)-g, adbSNP:370868497
complement(5658)-dbSNP:
complement(5658)-g, adbSNP:142767538
complement(5665)-t, cdbSNP:138720701
complement(5669)-t, cdbSNP:17091278
complement(5672)-t, cdbSNP:148984154
complement(5694)-g, adbSNP:368604132
complement(5698)-t, cdbSNP:201919534
complement(5712)-t, adbSNP:201552605
complement(5716)-t, cdbSNP:199755234
complement(5723)-g, adbSNP:200662317
complement(5727)-t, cdbSNP:138864419
complement(5765)-g, cdbSNP:201199853
complement(5766)-g, adbSNP:371607892
complement(5767)-t, cdbSNP:61731171
5771+c, gdbSNP:397516778
complement(5806)-g, adbSNP:373076710
complement(5807)-t, cdbSNP:150277296
complement(5857)-g, adbSNP:368881214
complement(5875)-dbSNP:
complement(5875)-g, adbSNP:377133201
complement(5876)-c, adbSNP:372265811
complement(5885)-t, cdbSNP:370158835
complement(5896)-c, adbSNP:139102144
complement(5899)-g, adbSNP:201560522
complement(5901)-t, cdbSNP:367876508
Gene SymbolMYH6
Gene Synonymalpha-MHC; ASD3; CMD1EE; CMH14; MYHC; MYHCA; SSS3
Chromosome14
Locus Map14q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002471 Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), mRNA. On-demand $2699.00 30
XM_005267694 PREDICTED: Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), transcript variant X1, mRNA. On-demand $2699.00 30
XM_006720151 PREDICTED: Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), transcript variant X3, mRNA. On-demand $2699.00 30
XM_006720152 PREDICTED: Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), transcript variant X4, mRNA. On-demand $2699.00 30
XM_005267695 PREDICTED: Homo sapiens myosin, heavy chain 6, cardiac muscle, alpha (MYH6), transcript variant X2, mRNA. On-demand $899.00 20
Title All-atom molecular dynamics simulations of actin-myosin interactions: a comparative study of cardiac alpha myosin, beta myosin, and fast skeletal muscle myosin .
Author Li M and Zheng W.
Journal Biochemistry 52 (47), 8393-8405 (2013)
Title Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders .
Author den Hoed M, Eijgelsheim M, Esko T, Brundel BJ, Peal DS, Evans DM, Nolte IM, Segre AV, Holm H, Handsaker RE, Westra HJ, Johnson T, Isaacs A, Yang J, Lundby A, Zhao JH, Kim YJ, Go MJ, Almgren P, Bochud M, Boucher G, Cornelis MC, Gudbjartsson D, Hadley D, van der Harst P, Hayward C, den Heijer M, Igl W, Jackson AU, Kutalik Z, Luan J, Kemp JP, Kristiansson K, Ladenvall C, Lorentzon M, Montasser ME, Njajou OT, O'Reilly PF, Padmanabhan S, St Pourcain B, Rankinen T, Salo P, Tanaka T, Timpson NJ, Vitart V, Waite L, Wheeler W, Zhang W, Draisma HH, Feitosa MF, Kerr KF, Lind PA, Mihailov E, Onland-Moret NC, Song C, Weedon MN, Xie W, Yengo L, Absher D, Albert CM, Alonso A, Arking DE, de Bakker PI, Balkau B, Barlassina C, Benaglio P, Bis JC, Bouatia-Naji N, Brage S, Chanock SJ, Chines PS, Chung M, Darbar D, Dina C, Dorr M, Elliott P, Felix SB, Fischer K, Fuchsberger C, de Geus EJ, Goyette P, Gudnason V, Harris TB, Hartikainen AL, Havulinna AS, Heckbert SR, Hicks AA, Hofman A, Holewijn S, Hoogstra-Berends F, Hottenga JJ, Jensen MK, Johansson A, Junttila J, Kaab S, Kanon B, Ketkar S, Khaw KT, Knowles JW, Kooner AS, Kors JA, Kumari M, Milani L, Laiho P, Lakatta EG, Langenberg C, Leusink M, Liu Y, Luben RN, Lunetta KL, Lynch SN, Markus MR, Marques-Vidal P, Mateo Leach I, McArdle WL, McCarroll SA, Medland SE, Miller KA, Montgomery GW, Morrison AC, Muller-Nurasyid M, Navarro P, Nelis M, O'Connell JR, O'Donnell CJ, Ong KK, Newman AB, Peters A, Polasek O, Pouta A, Pramstaller PP, Psaty BM, Rao DC, Ring SM, Rossin EJ, Rudan D, Sanna S, Scott RA, Sehmi JS, Sharp S, Shin JT, Singleton AB, Smith AV, Soranzo N, Spector TD, Stewart C, Stringham HM, Tarasov KV, Uitterlinden AG, Vandenput L, Hwang SJ, Whitfield JB, Wijmenga C, Wild SH, Willemsen G, Wilson JF, Witteman JC, Wong A, Wong Q, Jamshidi Y, Zitting P, Boer JM, Boomsma DI, Borecki IB, van Duijn CM, Ekelund U, Forouhi NG, Froguel P, Hingorani A, Ingelsson E, Kivimaki M, Kronmal RA, Kuh D, Lind L, Martin NG, Oostra BA, Pedersen NL, Quertermous T, Rotter JI, van der Schouw YT, Verschuren WM, Walker M, Albanes D, Arnar DO, Assimes TL, Bandinelli S, Boehnke M, de Boer RA, Bouchard C, Caulfield WL, Chambers JC, Curhan G, Cusi D, Eriksson J, Ferrucci L, van Gilst WH, Glorioso N, de Graaf J, Groop L, Gyllensten U, Hsueh WC, Hu FB, Huikuri HV, Hunter DJ, Iribarren C, Isomaa B, Jarvelin MR, Jula A, Kahonen M, Kiemeney LA, van der Klauw MM, Kooner JS, Kraft P, Iacoviello L, Lehtimaki T, Lokki ML, Mitchell BD, Navis G, Nieminen MS, Ohlsson C, Poulter NR, Qi L, Raitakari OT, Rimm EB, Rioux JD, Rizzi F, Rudan I, Salomaa V, Sever PS, Shields DC, Shuldiner AR, Sinisalo J, Stanton AV, Stolk RP, Strachan DP, Tardif JC, Thorsteinsdottir U, Tuomilehto J, van Veldhuisen DJ, Virtamo J, Viikari J, Vollenweider P, Waeber G, Widen E, Cho YS, Olsen JV, Visscher PM, Willer C, Franke L, Erdmann J, Thompson JR, Pfeufer A, Sotoodehnia N, Newton-Cheh C, Ellinor PT, Stricker BH, Metspalu A, Perola M, Beckmann JS, Smith GD, Stefansson K, Wareham NJ, Munroe PB, Sibon OC, Milan DJ, Snieder H, Samani NJ and Loos RJ.
Journal Nat. Genet. 45 (6), 621-631 (2013)
Title Common genetic variation near the connexin-43 gene is associated with resting heart rate in African Americans: a genome-wide association study of 13,372 participants .
Author Deo R, Nalls MA, Avery CL, Smith JG, Evans DS, Keller MF, Butler AM, Buxbaum SG, Li G, Miguel Quibrera P, Smith EN, Tanaka T, Akylbekova EL, Alonso A, Arking DE, Benjamin EJ, Berenson GS, Bis JC, Chen LY, Chen W, Cummings SR, Ellinor PT, Evans MK, Ferrucci L, Fox ER, Heckbert SR, Heiss G, Hsueh WC, Kerr KF, Limacher MC, Liu Y, Lubitz SA, Magnani JW, Mehra R, Marcus GM, Murray SS, Newman AB, Njajou O, North KE, Paltoo DN, Psaty BM, Redline SS, Reiner AP, Robinson JG, Rotter JI, Samdarshi TE, Schnabel RB, Schork NJ, Singleton AB, Siscovick D, Soliman EZ, Sotoodehnia N, Srinivasan SR, Taylor HA, Trevisan M, Zhang Z, Zonderman AB, Newton-Cheh C and Whitsel EA.
Journal Heart Rhythm 10 (3), 401-408 (2013)
Title MYH9-related disorders: report on a patient of Greek origin presenting with macroscopic hematuria and presenile cataract, caused by an R1165C mutation .
Author Economou M, Batzios SP, Pecci A, Printza N, Savoia A, Barozzi S, Theodoridou S, Teli A, Psillas G and Zafeiriou DI.
Journal J. Pediatr. Hematol. Oncol. 34 (6), 412-415 (2012)
Title Hypertrophic Cardiomyopathy Overview .
Author Cirino,A.L. and Ho,C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dilated Cardiomyopathy Overview .
Author Hershberger,R.E. and Morales,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Complete sequence of human cardiac alpha-myosin heavy chain gene and amino acid comparison to other myosins based on structural and functional differences .
Author Matsuoka R, Beisel KW, Furutani M, Arai S and Takao A.
Journal Am. J. Med. Genet. 41 (4), 537-547 (1991)
Title Determination of the 5' exon structure of the human cardiac alpha-myosin heavy chain gene .
Author Brand NJ, Dabhade N, Yacoub M and Barton PJ.
Journal Biochem. Biophys. Res. Commun. 179 (3), 1255-1258 (1991)
Title Nucleotide sequence of chimpanzee Fc and hinge regions .
Author Ehrlich PH, Moustafa ZA and Ostberg L.
Journal Mol. Immunol. 28 (4-5), 319-322 (1991)
Title A locus for familial hypertrophic cardiomyopathy is closely linked to the cardiac myosin heavy chain genes, CRI-L436, and CRI-L329 on chromosome 14 at q11-q12 .
Author Solomon SD, Geisterfer-Lowrance AA, Vosberg HP, Hiller G, Jarcho JA, Morton CC, McBride WO, Mitchell AL, Bale AE and McKenna WJ.
Journal Am. J. Hum. Genet. 47 (3), 389-394 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.