• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myosin, heavy chain 9, non-muscle (MYH9), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu22915 Homo sapiens myosin, heavy chain 9, non-muscle (MYH9), mRNA. pcDNA3.1+-DYK On-demand $2699.00 30
OHu22915C Homo sapiens myosin, heavy chain 9, non-muscle (MYH9), mRNA. Customized vector On-demand $2699.00 30

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002473.4, 225703132
Length 5883 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens myosin, heavy chain 9, non-muscle (MYH9), mRNA.
Product myosin-9
Comment

Summary: This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. [provided by RefSeq, Dec 2011].


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_002464.1
CDS 232..6114
Misc Feature(1)223..225
Misc Feature(2)223..225
Misc Feature(3)235..237
Misc Feature(4)235..237
Misc Feature(5)253..255
Misc Feature(6)262..264
Misc Feature(7)316..444
Misc Feature(8)460..2556
Misc Feature(9)502..504
Misc Feature(10)535..537
Misc Feature(11)order(595..606,610..615,757..780)
Misc Feature(12)922..939
Misc Feature(13)1126..1128
Misc Feature(14)1588..1611
Misc Feature(15)order(1672..1707,1714..1743)
Misc Feature(16)2191..2259
Misc Feature(17)2311..2355
Misc Feature(18)order(2350..2355,2362..2364,2380..2382,2389..2394,
Misc Feature(19)2491..2493
Misc Feature(20)2917..2919
Misc Feature(21)2980..2982
Misc Feature(22)3142..3678
Misc Feature(23)3301..3303
Misc Feature(24)3394..>3855
Misc Feature(25)3427..6000
Misc Feature(26)<3847..4020
Misc Feature(27)4300..4302
Misc Feature(28)4405..4407
Misc Feature(29)4441..4443
Misc Feature(30)4453..4455
Misc Feature(31)4459..4461
Misc Feature(32)4606..4608
Misc Feature(33)4798..5172
Misc Feature(34)5143..5145
Misc Feature(35)5371..5373
Misc Feature(36)6058..6060
Misc Feature(37)6058..6060
Misc Feature(38)6058..6060
Exon (1)1..212
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (2)213..564
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (3)565..721
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (4)722..749
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (5)750..843
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (6)844..936
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (7)937..1000
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (8)1001..1099
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (9)1100..1243
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (10)1244..1339
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (11)1340..1458
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (12)1459..1611
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (13)1612..1785
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (14)1786..1959
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (15)1960..2074
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (16)2075..2268
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (17)2269..2390
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (18)2391..2460
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (19)2461..2621
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (20)2622..2730
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (21)2731..2862
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (22)2863..3069
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (23)3070..3207
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (24)3208..3331
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (25)3332..3503
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (26)3504..3716
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (27)3717..3861
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (28)3862..4068
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (29)4069..4173
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (30)4174..4326
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (31)4327..4575
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (32)4576..4788
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (33)4789..5001
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (34)5002..5163
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (35)5164..5292
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (36)5293..5381
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (37)5382..5505
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (38)5506..5714
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (39)5715..5823
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (40)5824..5996
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (41)5997..7505
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Translation MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ KLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK FNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEE NRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCL ETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLE KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLK DLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQ YKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK LRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-dbSNP:
complement(31)-t, cdbSNP:189394948
complement(231)-g, adbSNP:144345740
complement(238)-t, g, cdbSNP:56200894
complement(249)-g, adbSNP:141055332
complement(251)-t, cdbSNP:376417391
complement(252)-g, adbSNP:148130685
complement(263)-t, cdbSNP:201415443
complement(335)-g, adbSNP:375000039
complement(363)-g, adbSNP:138526426
complement(367)-g, adbSNP:147122501
complement(396)-g, adbSNP:141948797
complement(424)-t, cdbSNP:377348805
complement(464)-g, adbSNP:150313549
complement(468)-t, cdbSNP:140215106
complement(507)-g, adbSNP:201634392
510+c, gdbSNP:121913655
518+c, tdbSNP:121913657
complement(540)-t, cdbSNP:151188738
complement(549)-g, adbSNP:202117532
complement(564)-g, adbSNP:372687282
complement(606)-dbSNP:
complement(606)-t, cdbSNP:142155458
complement(651)-g, adbSNP:372621048
complement(663)-g, adbSNP:370027096
complement(681)-g, adbSNP:141048719
complement(739)-dbSNP:
complement(739)-t, cdbSNP:376494037
complement(774)-dbSNP:
complement(774)-t, cdbSNP:146514663
complement(807)-t, cdbSNP:369880291
complement(816)-t, cdbSNP:374395918
complement(822)-t, cdbSNP:140241271
complement(846)-dbSNP:
complement(846)-g, adbSNP:139466141
complement(852)-t, cdbSNP:370198812
complement(894)-g, adbSNP:375965637
complement(909)-g, adbSNP:372262711
complement(945)-dbSNP:
complement(945)-g, adbSNP:200833195
complement(952)-t, cdbSNP:142891887
complement(975)-g, adbSNP:371035780
complement(1044)-dbSNP:
complement(1044)-t, c, adbSNP:112759129
complement(1101)-dbSNP:
complement(1101)-g, adbSNP:144683949
complement(1102)-t, cdbSNP:371205546
complement(1110)-t, cdbSNP:377539123
complement(1122)-g, adbSNP:371017134
complement(1137)-g, cdbSNP:375657864
complement(1159)-t, cdbSNP:149789202
complement(1164)-g, adbSNP:202045249
complement(1165)-t, cdbSNP:369011405
complement(1219)-t, cdbSNP:376652889
complement(1222)-t, cdbSNP:139798339
complement(1246)-dbSNP:
complement(1246)-t, gdbSNP:369633699
complement(1266)-g, cdbSNP:186295134
complement(1288)-t, cdbSNP:375702969
complement(1314)-g, adbSNP:56001030
complement(1380)-dbSNP:
complement(1380)-g, adbSNP:143974891
complement(1389)-g, adbSNP:138502859
complement(1398)-g, adbSNP:114048959
complement(1407)-t, cdbSNP:143316848
complement(1409)-t, cdbSNP:202023656
complement(1419)-t, cdbSNP:147972823
complement(1431)-g, adbSNP:143458435
complement(1432)-t, cdbSNP:369581570
complement(1443)-t, cdbSNP:148832136
complement(1473)-dbSNP:
complement(1473)-g, adbSNP:138436678
complement(1491)-t, cdbSNP:369202401
complement(1575)-g, adbSNP:150125254
complement(1684)-dbSNP:
complement(1684)-g, adbSNP:112719772
complement(1704)-t, cdbSNP:141006061
complement(1710)-t, cdbSNP:376262583
complement(1722)-g, adbSNP:146487404
complement(1725)-t, cdbSNP:368139360
complement(1735)-t, cdbSNP:374837768
complement(1750)-t, cdbSNP:377410439
complement(1768)-t, cdbSNP:375899392
complement(1797)-dbSNP:
complement(1797)-t, cdbSNP:145517108
complement(1809)-g, cdbSNP:201827299
complement(1836..1837)-, gdbSNP:34914499
complement(1857)-g, adbSNP:7285745
complement(1867)-t, cdbSNP:376395196
complement(1917)-t, cdbSNP:199506577
complement(1953)-g, adbSNP:373381680
complement(2019)-dbSNP:
complement(2019)-g, adbSNP:113130911
complement(2025)-t, gdbSNP:371211555
complement(2058)-t, cdbSNP:375576418
complement(2081)-dbSNP:
complement(2081)-t, cdbSNP:151240427
complement(2082)-g, adbSNP:373421251
complement(2088)-g, adbSNP:199644052
complement(2105)-g, cdbSNP:376240562
complement(2115)-t, cdbSNP:142260563
complement(2122)-t, cdbSNP:200546575
complement(2172)-t, cdbSNP:148725860
complement(2211)-t, cdbSNP:200975323
complement(2223)-t, cdbSNP:202125487
complement(2272)-dbSNP:
complement(2272)-t, cdbSNP:145241551
complement(2292)-g, adbSNP:143801000
complement(2316)-g, adbSNP:375953430
2335+c, tdbSNP:80338826
2336+a, gdbSNP:80338827
2345+a, gdbSNP:80338828
complement(2346)-g, adbSNP:372243275
complement(2414)-dbSNP:
complement(2414)-g, cdbSNP:371833667
complement(2436)-g, adbSNP:370860479
complement(2447)-g, adbSNP:368367291
complement(2452)-t, cdbSNP:140032888
complement(2487)-dbSNP:
complement(2487)-g, adbSNP:9619601
complement(2490)-c, adbSNP:371033188
complement(2526)-g, adbSNP:150133983
complement(2571)-g, adbSNP:370156367
complement(2574)-g, cdbSNP:143290101
complement(2575)-t, cdbSNP:139966058
complement(2614)-c, adbSNP:374505336
complement(2625)-dbSNP:
complement(2625)-t, cdbSNP:150702310
complement(2653)-t, cdbSNP:201967008
complement(2673)-t, cdbSNP:113783861
complement(2679)-g, adbSNP:113285582
complement(2748)-dbSNP:
complement(2748)-t, cdbSNP:34498733
complement(2759)-t, cdbSNP:144633299
complement(2796)-t, cdbSNP:370413515
complement(2814)-g, cdbSNP:371397198
complement(2822)-g, adbSNP:142467329
complement(2866)-dbSNP:
complement(2866)-t, g, cdbSNP:200328859
complement(2889)-t, cdbSNP:143927347
complement(2910)-g, adbSNP:145476120
complement(2922)-g, adbSNP:148883810
complement(2944)-g, adbSNP:377115843
complement(2952)-g, adbSNP:148112044
complement(2953)-t, cdbSNP:150177079
complement(3002)-g, adbSNP:140933307
complement(3039)-t, cdbSNP:200550959
complement(3046)-t, cdbSNP:368994508
complement(3102)-dbSNP:
complement(3102)-g, adbSNP:374840260
complement(3103)-t, cdbSNP:151036570
complement(3131)-t, adbSNP:16996652
complement(3143)-g, cdbSNP:199654108
complement(3144)-t, cdbSNP:200763055
complement(3189)-g, cdbSNP:199520053
complement(3196)-t, gdbSNP:201389127
complement(3243)-dbSNP:
complement(3243)-g, adbSNP:373350321
complement(3282)-g, adbSNP:145404206
complement(3390)-dbSNP:
complement(3390)-c, adbSNP:201951100
complement(3408)-g, adbSNP:140004540
complement(3409)-g, adbSNP:56767084
complement(3412)-t, adbSNP:199971000
complement(3415)-t, cdbSNP:368438600
complement(3421)-t, adbSNP:147911658
complement(3423)-g, adbSNP:144807538
complement(3426)-t, gdbSNP:148781875
complement(3432)-g, adbSNP:144389749
complement(3438)-t, gdbSNP:149641558
complement(3447)-t, cdbSNP:139441456
complement(3477)-t, cdbSNP:147961725
complement(3486)-g, adbSNP:142427583
complement(3551)-dbSNP:
complement(3551)-t, cdbSNP:137924205
complement(3571)-g, adbSNP:200901330
complement(3576)-t, cdbSNP:875725
complement(3609)-g, adbSNP:372076600
complement(3628)-g, cdbSNP:368797590
complement(3631)-t, gdbSNP:200604312
complement(3660)-c, adbSNP:710181
complement(3683)-g, adbSNP:375081687
3695+c, tdbSNP:121913656
3724+dbSNP:
3724+c, tdbSNP:80338829
3725+g, tdbSNP:80338830
complement(3785)-g, cdbSNP:199800916
complement(3823)-t, cdbSNP:200732002
complement(3854)-g, adbSNP:201153545
complement(3860)-t, cdbSNP:368114068
complement(3876)-dbSNP:
complement(3876)-g, adbSNP:377686629
complement(3884)-g, adbSNP:373722926
complement(3903)-g, adbSNP:148258578
complement(3907)-g, adbSNP:375797448
complement(3908)-c, adbSNP:200697030
complement(3924)-g, adbSNP:148043336
complement(3937)-g, adbSNP:369204192
complement(3987)-c, adbSNP:149113660
complement(4016)-t, cdbSNP:138270050
complement(4017)-t, gdbSNP:192365600
complement(4028)-t, cdbSNP:375738970
complement(4048)-t, cdbSNP:147031322
complement(4069)-dbSNP:
complement(4069)-t, cdbSNP:141582478
complement(4083)-g, adbSNP:200272787
complement(4142)-g, adbSNP:371416304
complement(4144)-t, cdbSNP:372780340
complement(4145)-g, adbSNP:141904682
complement(4146)-t, cdbSNP:183685723
complement(4195)-dbSNP:
complement(4195)-g, adbSNP:201269631
complement(4239)-g, adbSNP:373378393
complement(4255)-g, adbSNP:147901502
complement(4281)-g, cdbSNP:375955867
complement(4308)-g, adbSNP:199693307
complement(4310)-g, cdbSNP:373384951
complement(4311)-g, adbSNP:369927103
complement(4336)-dbSNP:
complement(4336)-t, cdbSNP:368982363
complement(4350)-t, cdbSNP:200894704
complement(4354)-g, cdbSNP:202033925
complement(4359)-g, adbSNP:199506931
complement(4381)-g, cdbSNP:200616409
complement(4429)-g, adbSNP:76368635
complement(4432)-g, adbSNP:116972183
complement(4449)-t, g, adbSNP:142957635
complement(4450)-t, cdbSNP:199639878
complement(4456)-t, cdbSNP:34292387
complement(4479)-t, cdbSNP:375293824
complement(4489)-g, cdbSNP:200510675
complement(4498)-c, adbSNP:146401386
4501+a, c, g, tdbSNP:80338831
complement(4533)-g, cdbSNP:143979758
complement(4537)-t, cdbSNP:373912645
complement(4539)-t, cdbSNP:369577944
complement(4575)-t, cdbSNP:201492937
complement(4584)-dbSNP:
complement(4584)-t, cdbSNP:373177496
complement(4590)-t, cdbSNP:202127454
complement(4622)-t, cdbSNP:199968414
complement(4624)-t, cdbSNP:201248264
complement(4627)-g, adbSNP:139134727
complement(4638)-t, cdbSNP:56258227
complement(4678)-g, adbSNP:368105628
complement(4680)-t, cdbSNP:146211660
complement(4709)-t, gdbSNP:371535403
complement(4710)-t, cdbSNP:149271663
complement(4738)-g, adbSNP:138561532
complement(4742)-g, adbSNP:150565890
complement(4743)-t, cdbSNP:371508662
complement(4774)-t, cdbSNP:141750518
complement(4787)-t, cdbSNP:138193963
4794+dbSNP:
4794+c, tdbSNP:11549907
complement(4813)-t, g, adbSNP:201405521
4826+a, gdbSNP:11549910
4831+c, gdbSNP:11549909
complement(4848)-t, cdbSNP:369996404
complement(4884)-g, adbSNP:375806364
complement(4895)-t, cdbSNP:141543499
complement(4901)-t, cdbSNP:373393111
complement(4915)-g, cdbSNP:139039608
4947+c, tdbSNP:397516780
complement(4957)-g, adbSNP:199722926
complement(4958)-t, cdbSNP:143269195
complement(4984)-t, gdbSNP:149169068
complement(5031)-dbSNP:
complement(5031)-g, adbSNP:201223994
complement(5048)-g, adbSNP:145319741
complement(5049)-t, cdbSNP:202132383
complement(5062)-t, cdbSNP:150029980
complement(5064)-g, cdbSNP:374641578
complement(5103)-c, adbSNP:2269530
complement(5107)-t, cdbSNP:2269529
complement(5109)-g, adbSNP:143947828
complement(5127)-g, adbSNP:372299120
complement(5130)-t, cdbSNP:5756130
complement(5133)-g, adbSNP:146184921
complement(5183)-dbSNP:
complement(5183)-g, adbSNP:142094977
complement(5187)-g, adbSNP:148632964
complement(5188)-g, cdbSNP:375322236
complement(5203)-g, adbSNP:143972348
complement(5204)-t, cdbSNP:375515914
complement(5206)-t, cdbSNP:371410108
complement(5221)-t, adbSNP:377635445
complement(5241)-t, cdbSNP:76069100
complement(5244)-g, adbSNP:367872152
complement(5257)-t, cdbSNP:138158369
complement(5267)-t, cdbSNP:113188836
complement(5280)-t, gdbSNP:147419066
complement(5304)-dbSNP:
complement(5304)-g, adbSNP:201022139
complement(5311)-g, adbSNP:142904663
complement(5315)-g, adbSNP:184358592
complement(5319)-t, cdbSNP:138998795
complement(5320)-g, adbSNP:372871106
complement(5349)-t, cdbSNP:34849414
complement(5355)-g, adbSNP:369135992
complement(5361)-g, adbSNP:150198935
complement(5373)-g, adbSNP:141854577
complement(5374)-t, cdbSNP:148109368
complement(5407)-dbSNP:
complement(5407)-g, adbSNP:375070090
complement(5410)-t, gdbSNP:373380499
complement(5412)-t, cdbSNP:115170675
complement(5416)-c, adbSNP:140662138
complement(5419)-g, adbSNP:201021615
complement(5478)-g, adbSNP:146848144
complement(5481)-g, adbSNP:371244334
complement(5508)-dbSNP:
complement(5508)-g, adbSNP:183105164
complement(5523)-g, adbSNP:371842998
complement(5548)-t, cdbSNP:190450967
complement(5554)-t, cdbSNP:145139708
complement(5592)-t, gdbSNP:201463106
complement(5609)-t, cdbSNP:141440715
complement(5637)-t, cdbSNP:374979658
complement(5655)-g, adbSNP:370371349
complement(5687)-c, adbSNP:368440234
complement(5701)-t, cdbSNP:376154206
5752+dbSNP:
5752+a, gdbSNP:80338834
complement(5773)-g, cdbSNP:201174456
complement(5776)-g, adbSNP:368994883
complement(5802)-g, adbSNP:200409945
complement(5827)-dbSNP:
complement(5827)-t, cdbSNP:371765378
complement(5860)-g, adbSNP:375674671
complement(5877)-g, adbSNP:200029600
complement(5901)-g, adbSNP:376839692
complement(5911)-t, gdbSNP:372051836
complement(5927)-t, cdbSNP:191342427
complement(5940)-g, adbSNP:145444485
complement(5944)-g, cdbSNP:368149181
complement(5948)-g, adbSNP:149663189
complement(5952)-g, adbSNP:139486152
complement(5973)-g, adbSNP:150728943
complement(6000)-dbSNP:
complement(6000)-g, adbSNP:370834297
complement(6001)-t, cdbSNP:371476289
complement(6012)-c, adbSNP:80050551
complement(6018)-g, adbSNP:367698156
complement(6019)-t, cdbSNP:142565774
6028+c, tdbSNP:80338835
complement(6045)-g, adbSNP:147409380
complement(6046)-t, cdbSNP:115031369
complement(6049)-t, cdbSNP:140588099
complement(6088)-t, cdbSNP:200652984
complement(6108)-g, adbSNP:144179406
complement(6109)-t, cdbSNP:149560153
complement(6122)-g, adbSNP:201455315
complement(6124)-g, adbSNP:185260008
complement(6155)-t, cdbSNP:199511248
complement(6195)-g, adbSNP:56134611
complement(6250..6251)-tt, ggdbSNP:369279945
complement(6250)-t, gdbSNP:115869378
complement(6251)-t, gdbSNP:114268057
complement(6252)-t, gdbSNP:368528822
complement(6307)-g, adbSNP:181364853
complement(6352)-t, g, c, adbSNP:11703176
complement(6357)-g, adbSNP:136201
complement(6375)-g, cdbSNP:11089787
complement(6426)-g, adbSNP:16996639
complement(6439)-g, adbSNP:189775203
6508+c, gdbSNP:11549908
complement(6514)-t, cdbSNP:184405957
complement(6534)-g, adbSNP:191310715
complement(6537)-g, adbSNP:187906538
complement(6588)-g, adbSNP:55979529
complement(6589)-t, cdbSNP:149773047
complement(6703)-t, cdbSNP:116572976
complement(6710)-t, cdbSNP:136200
complement(6743)-g, adbSNP:376656356
6772+c, tdbSNP:1056049
complement(6800)-g, adbSNP:55994070
complement(6803)-, gdbSNP:35347691
complement(6818)-g, cdbSNP:184752589
6846+c, tdbSNP:12107
complement(6868)-c, adbSNP:368536447
6914+c, tdbSNP:7078
complement(6972)-c, adbSNP:371270257
complement(7020)-c, adbSNP:192511111
7099+a, gdbSNP:11549912
complement(7133)-c, adbSNP:112039601
complement(7263..7264)-g, adbSNP:11549911
complement(7274)-, adbSNP:56058205
complement(7288)-g, adbSNP:188489592
complement(7318)-t, adbSNP:56360445
complement(7343)-g, cdbSNP:5995275
complement(7359)-t, cdbSNP:183604549
7382+a, cdbSNP:3205191
complement(7385)-g, adbSNP:191256255
7414+c, tdbSNP:8226
7428+c, tdbSNP:2481
complement(7443)-g, adbSNP:146582828
complement(7501)-t, adbSNP:111959795
Gene SymbolMYH9
Gene SynonymBDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Chromosome22
Locus Map22q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002473 Homo sapiens myosin, heavy chain 9, non-muscle (MYH9), mRNA. On-demand $2699.00 30
Title Myosin IIA is critical for organelle distribution and F-actin organization in megakaryocytes and platelets .
Author Pertuy F, Eckly A, Weber J, Proamer F, Rinckel JY, Lanza F, Gachet
Journal Blood 123 (8), 1261-1269 (2014)
Title Direct in vivo RNAi screen unveils myosin IIa as a tumor suppressor of squamous cell carcinomas .
Author Schramek D, Sendoel A, Segal JP, Beronja S, Heller E, Oristian D, Reva B and Fuchs E.
Journal Science 343 (6168), 309-313 (2014)
Title Characterization of three full-length human nonmuscle myosin II paralogs .
Author Billington N, Wang A, Mao J, Adelstein RS and Sellers JR.
Journal J. Biol. Chem. 288 (46), 33398-33410 (2013)
Title Epistatic role of the MYH9/APOL1 region on familial hematuria genes .
Author Voskarides K, Demosthenous P, Papazachariou L, Arsali M, Athanasiou Y, Zavros M, Stylianou K, Xydakis D, Daphnis E, Gale DP, Maxwell PH, Elia A, Pattaro C, Pierides A and Deltas C.
Journal PLoS ONE 8 (3), E57925 (2013)
Title Identification of rare variants from exome sequence in a large pedigree with autism .
Author Marchani EE, Chapman NH, Cheung CY, Ankenman K, Stanaway IB, Coon HH, Nickerson D, Bernier R, Brkanac Z and Wijsman EM.
Journal Hum. Hered. 74 (3-4), 153-164 (2012)
Title MYH9-Related Disorders .
Author Savoia,A. and Balduini,C.L.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Cellular myosin heavy chain in human leukocytes: isolation of 5' cDNA clones, characterization of the protein, chromosomal localization, and upregulation during myeloid differentiation .
Author Toothaker LE, Gonzalez DA, Tung N, Lemons RS, Le Beau MM, Arnaout MA, Clayton LK and Tenen DG.
Journal Blood 78 (7), 1826-1833 (1991)
Title Human nonmuscle myosin heavy chains are encoded by two genes located on different chromosomes .
Author Simons M, Wang M, McBride OW, Kawamoto S, Yamakawa K, Gdula D, Adelstein RS and Weir L.
Journal Circ. Res. 69 (2), 530-539 (1991)
Title Human nonmuscle myosin heavy chain mRNA: generation of diversity through alternative polyadenylylation .
Author Saez CG, Myers JC, Shows TB and Leinwand LA.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (3), 1164-1168 (1990)
Title The interaction of C-protein with heavy meromyosin and subfragment-2 .
Author Starr,R. and Offer,G.
Journal Biochem. J. 171 (3), 813-816 (1978)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.