• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myosin, heavy chain 9, non-muscle (MYH9), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002473 Homo sapiens myosin, heavy chain 9, non-muscle (MYH9), mRNA. GenEZ ORF Cloning On-demand $2699.00 30

*Business Day

Related Services

RefSeq Version NM_002473.4, 225703132
Length 7505 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens myosin, heavy chain 9, non-muscle (MYH9), mRNA.
Product myosin-9
Comment

Summary: This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. [provided by RefSeq, Dec 2011].


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_002464.1
CDS 232..6114
Misc Feature(1)223..225
Misc Feature(2)223..225
Misc Feature(3)235..237
Misc Feature(4)235..237
Misc Feature(5)253..255
Misc Feature(6)262..264
Misc Feature(7)316..444
Misc Feature(8)457..2559
Misc Feature(9)460..2556
Misc Feature(10)502..504
Misc Feature(11)535..537
Misc Feature(12)order(595..606,610..615,757..780)
Misc Feature(13)922..939
Misc Feature(14)1126..1128
Misc Feature(15)1588..1611
Misc Feature(16)order(1672..1707,1714..1743)
Misc Feature(17)2191..2259
Misc Feature(18)2311..2355
Misc Feature(19)order(2350..2355,2362..2364,2380..2382,2389..2394,
Misc Feature(20)2491..2493
Misc Feature(21)2917..2919
Misc Feature(22)2980..2982
Misc Feature(23)3301..3303
Misc Feature(24)3502..6000
Misc Feature(25)4300..4302
Misc Feature(26)4405..4407
Misc Feature(27)4441..4443
Misc Feature(28)4453..4455
Misc Feature(29)4459..4461
Misc Feature(30)4606..4608
Misc Feature(31)4801..>5052
Misc Feature(32)5143..5145
Misc Feature(33)5371..5373
Misc Feature(34)6058..6060
Misc Feature(35)6058..6060
Misc Feature(36)6058..6060
Exon (1)1..212
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (2)213..564
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (3)565..721
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (4)722..749
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (5)750..843
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (6)844..936
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (7)937..1000
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (8)1001..1099
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (9)1100..1243
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (10)1244..1339
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (11)1340..1458
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (12)1459..1611
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (13)1612..1785
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (14)1786..1959
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (15)1960..2074
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (16)2075..2268
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (17)2269..2390
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (18)2391..2460
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (19)2461..2621
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (20)2622..2730
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (21)2731..2862
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (22)2863..3069
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (23)3070..3207
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (24)3208..3331
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (25)3332..3503
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (26)3504..3716
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (27)3717..3861
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (28)3862..4068
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (29)4069..4173
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (30)4174..4326
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (31)4327..4575
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (32)4576..4788
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (33)4789..5001
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (34)5002..5163
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (35)5164..5292
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (36)5293..5381
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (37)5382..5505
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (38)5506..5714
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (39)5715..5823
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (40)5824..5996
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Exon (41)5997..7505
Gene:MYH9
Gene Synonym:BDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Translation MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ KLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK FNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEE NRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCL ETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLE KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLK DLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQ YKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK LRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-dbSNP:
complement(31)-t, cdbSNP:189394948
complement(231)-g, adbSNP:144345740
complement(238)-t, g, cdbSNP:56200894
complement(249)-g, adbSNP:141055332
complement(252)-g, adbSNP:148130685
complement(263)-t, cdbSNP:201415443
complement(363)-g, adbSNP:138526426
complement(367)-g, adbSNP:147122501
complement(396)-g, adbSNP:141948797
complement(462)-t, cdbSNP:137952158
complement(464)-g, adbSNP:150313549
complement(468)-t, cdbSNP:140215106
complement(507)-g, adbSNP:201634392
complement(510)-g, cdbSNP:121913655
complement(518)-t, cdbSNP:121913657
complement(540)-t, cdbSNP:151188738
complement(549)-g, adbSNP:202117532
complement(606)-dbSNP:
complement(606)-t, cdbSNP:142155458
complement(681)-g, adbSNP:141048719
complement(774)-dbSNP:
complement(774)-t, cdbSNP:146514663
complement(822)-t, cdbSNP:140241271
complement(846)-dbSNP:
complement(846)-g, adbSNP:139466141
complement(945)-dbSNP:
complement(945)-g, adbSNP:200833195
complement(952)-t, cdbSNP:142891887
complement(1044)-dbSNP:
complement(1044)-t, c, adbSNP:112759129
complement(1101)-dbSNP:
complement(1101)-g, adbSNP:144683949
complement(1159)-t, cdbSNP:149789202
complement(1164)-g, adbSNP:202045249
complement(1222)-t, cdbSNP:139798339
complement(1266)-dbSNP:
complement(1266)-g, cdbSNP:186295134
complement(1314)-g, adbSNP:56001030
complement(1380)-dbSNP:
complement(1380)-g, adbSNP:143974891
complement(1389)-g, adbSNP:138502859
complement(1398)-g, adbSNP:114048959
complement(1407)-t, cdbSNP:143316848
complement(1409)-t, cdbSNP:202023656
complement(1419)-t, cdbSNP:147972823
complement(1431)-g, adbSNP:143458435
complement(1443)-t, cdbSNP:148832136
complement(1473)-dbSNP:
complement(1473)-g, adbSNP:138436678
complement(1575)-g, adbSNP:150125254
complement(1684)-dbSNP:
complement(1684)-g, adbSNP:112719772
complement(1704)-t, cdbSNP:141006061
complement(1722)-g, adbSNP:146487404
complement(1797)-dbSNP:
complement(1797)-t, cdbSNP:145517108
complement(1809)-g, cdbSNP:201827299
complement(1836..1837)-, gdbSNP:34914499
complement(1857)-g, adbSNP:7285745
complement(1917)-t, cdbSNP:199506577
complement(2019)-dbSNP:
complement(2019)-g, adbSNP:113130911
complement(2081)-dbSNP:
complement(2081)-t, cdbSNP:151240427
complement(2088)-g, adbSNP:199644052
complement(2115)-t, cdbSNP:142260563
complement(2122)-t, cdbSNP:200546575
complement(2172)-t, cdbSNP:148725860
complement(2211)-t, cdbSNP:200975323
complement(2223)-t, cdbSNP:202125487
complement(2272)-dbSNP:
complement(2272)-t, cdbSNP:145241551
complement(2292)-g, adbSNP:143801000
complement(2335)-t, cdbSNP:80338826
complement(2336)-g, adbSNP:80338827
complement(2345)-g, adbSNP:80338828
complement(2452)-dbSNP:
complement(2452)-t, cdbSNP:140032888
complement(2487)-dbSNP:
complement(2487)-g, adbSNP:9619601
complement(2526)-g, adbSNP:150133983
complement(2574)-g, cdbSNP:143290101
complement(2575)-t, cdbSNP:139966058
complement(2625)-dbSNP:
complement(2625)-t, cdbSNP:150702310
complement(2653)-t, cdbSNP:201967008
complement(2673)-t, cdbSNP:113783861
complement(2679)-g, adbSNP:113285582
complement(2748)-dbSNP:
complement(2748)-t, cdbSNP:34498733
complement(2759)-t, cdbSNP:144633299
complement(2822)-g, adbSNP:142467329
complement(2823)-t, cdbSNP:137986197
complement(2866)-dbSNP:
complement(2866)-t, gdbSNP:200328859
complement(2889)-t, cdbSNP:143927347
complement(2910)-g, adbSNP:145476120
complement(2922)-g, adbSNP:148883810
complement(2952)-g, adbSNP:148112044
complement(2953)-t, cdbSNP:150177079
complement(3002)-g, adbSNP:140933307
complement(3039)-t, cdbSNP:200550959
complement(3103)-dbSNP:
complement(3103)-t, cdbSNP:151036570
complement(3131)-t, adbSNP:16996652
complement(3143)-g, cdbSNP:199654108
complement(3144)-t, cdbSNP:200763055
complement(3189)-g, cdbSNP:199520053
complement(3196)-t, gdbSNP:201389127
complement(3282)-dbSNP:
complement(3282)-g, adbSNP:145404206
complement(3390)-dbSNP:
complement(3390)-c, adbSNP:201951100
complement(3408)-g, adbSNP:140004540
complement(3409)-g, adbSNP:56767084
complement(3412)-t, adbSNP:199971000
complement(3421)-t, adbSNP:147911658
complement(3423)-g, adbSNP:144807538
complement(3426)-t, gdbSNP:148781875
complement(3432)-g, adbSNP:144389749
complement(3438)-t, gdbSNP:149641558
complement(3447)-t, cdbSNP:139441456
complement(3477)-t, cdbSNP:147961725
complement(3486)-g, adbSNP:142427583
complement(3551)-dbSNP:
complement(3551)-t, cdbSNP:137924205
complement(3571)-g, adbSNP:200901330
complement(3576)-t, cdbSNP:875725
complement(3631)-t, gdbSNP:200604312
complement(3642)-, adbSNP:5845264
complement(3660)-c, adbSNP:710181
complement(3695)-t, cdbSNP:121913656
complement(3724)-dbSNP:
complement(3724)-t, cdbSNP:80338829
complement(3725)-t, gdbSNP:80338830
complement(3785)-g, cdbSNP:199800916
complement(3823)-t, cdbSNP:200732002
complement(3854)-g, adbSNP:201153545
complement(3903)-dbSNP:
complement(3903)-g, adbSNP:148258578
complement(3908)-c, adbSNP:200697030
complement(3924)-g, adbSNP:148043336
complement(3987)-c, adbSNP:149113660
complement(4016)-t, cdbSNP:138270050
complement(4017)-t, gdbSNP:192365600
complement(4048)-t, cdbSNP:147031322
complement(4069)-dbSNP:
complement(4069)-t, cdbSNP:141582478
complement(4083)-g, adbSNP:200272787
complement(4145)-g, adbSNP:141904682
complement(4146)-t, cdbSNP:183685723
complement(4195)-dbSNP:
complement(4195)-g, adbSNP:201269631
complement(4255)-g, adbSNP:147901502
complement(4256)-t, cdbSNP:144770618
complement(4308)-g, adbSNP:199693307
complement(4350)-dbSNP:
complement(4350)-t, cdbSNP:200894704
complement(4354)-g, cdbSNP:202033925
complement(4359)-g, adbSNP:199506931
complement(4381)-g, cdbSNP:200616409
complement(4429)-g, adbSNP:76368635
complement(4432)-g, adbSNP:116972183
complement(4449)-t, g, adbSNP:142957635
complement(4450)-t, cdbSNP:199639878
complement(4456)-t, cdbSNP:34292387
complement(4489)-g, cdbSNP:200510675
complement(4498)-c, adbSNP:146401386
complement(4501)-t, g, c, adbSNP:80338831
complement(4533)-g, cdbSNP:143979758
complement(4575)-t, cdbSNP:201492937
complement(4590)-dbSNP:
complement(4590)-t, cdbSNP:202127454
complement(4622)-t, cdbSNP:199968414
complement(4624)-t, cdbSNP:201248264
complement(4627)-g, adbSNP:139134727
complement(4638)-t, cdbSNP:56258227
complement(4680)-t, cdbSNP:146211660
complement(4710)-t, cdbSNP:149271663
complement(4738)-g, adbSNP:138561532
complement(4742)-g, adbSNP:150565890
complement(4774)-t, cdbSNP:141750518
complement(4787)-t, cdbSNP:138193963
complement(4794)-dbSNP:
complement(4794)-t, cdbSNP:11549907
complement(4813)-t, gdbSNP:201405521
complement(4826)-g, adbSNP:11549910
complement(4831)-g, cdbSNP:11549909
complement(4895)-t, cdbSNP:141543499
complement(4915)-g, cdbSNP:139039608
complement(4957)-g, adbSNP:199722926
complement(4958)-t, cdbSNP:143269195
complement(4984)-t, gdbSNP:149169068
complement(5031)-dbSNP:
complement(5031)-g, adbSNP:201223994
complement(5048)-g, adbSNP:145319741
complement(5049)-t, cdbSNP:202132383
complement(5062)-t, cdbSNP:150029980
complement(5103)-c, adbSNP:2269530
complement(5107)-t, cdbSNP:2269529
complement(5109)-g, adbSNP:143947828
complement(5130)-t, cdbSNP:5756130
complement(5133)-g, adbSNP:146184921
complement(5183)-dbSNP:
complement(5183)-g, adbSNP:142094977
complement(5187)-g, adbSNP:148632964
complement(5203)-g, adbSNP:143972348
complement(5241)-t, cdbSNP:76069100
complement(5257)-t, cdbSNP:138158369
complement(5267)-t, cdbSNP:113188836
complement(5280)-t, gdbSNP:147419066
complement(5304)-dbSNP:
complement(5304)-g, adbSNP:201022139
complement(5311)-g, adbSNP:142904663
complement(5315)-g, adbSNP:184358592
complement(5319)-t, cdbSNP:138998795
complement(5349)-t, cdbSNP:34849414
complement(5361)-g, adbSNP:150198935
complement(5373)-g, adbSNP:141854577
complement(5374)-t, cdbSNP:148109368
complement(5412)-dbSNP:
complement(5412)-t, cdbSNP:115170675
complement(5416)-c, adbSNP:140662138
complement(5419)-g, adbSNP:201021615
complement(5478)-g, adbSNP:146848144
complement(5508)-dbSNP:
complement(5508)-g, adbSNP:183105164
complement(5548)-t, cdbSNP:190450967
complement(5554)-t, cdbSNP:145139708
complement(5592)-t, gdbSNP:201463106
complement(5609)-t, cdbSNP:141440715
complement(5752)-dbSNP:
complement(5752)-g, adbSNP:80338834
complement(5773)-g, cdbSNP:201174456
complement(5802)-g, adbSNP:200409945
complement(5877)-dbSNP:
complement(5877)-g, adbSNP:200029600
complement(5927)-t, cdbSNP:191342427
complement(5940)-g, adbSNP:145444485
complement(5948)-g, adbSNP:149663189
complement(5952)-g, adbSNP:139486152
complement(5973)-g, adbSNP:150728943
complement(6012)-dbSNP:
complement(6012)-c, adbSNP:80050551
complement(6019)-t, cdbSNP:142565774
complement(6028)-t, cdbSNP:80338835
complement(6042)-t, cdbSNP:139624264
complement(6045)-g, adbSNP:147409380
complement(6046)-t, cdbSNP:115031369
complement(6049)-t, cdbSNP:140588099
complement(6088)-t, cdbSNP:200652984
complement(6108)-g, adbSNP:144179406
complement(6109)-t, cdbSNP:149560153
complement(6122)-g, adbSNP:201455315
complement(6124)-g, adbSNP:185260008
complement(6155)-t, cdbSNP:199511248
complement(6195)-g, adbSNP:56134611
complement(6250)-t, gdbSNP:115869378
complement(6251)-t, gdbSNP:114268057
complement(6307)-g, adbSNP:181364853
complement(6352)-t, g, c, adbSNP:11703176
complement(6357)-g, adbSNP:136201
complement(6375)-g, cdbSNP:11089787
complement(6426)-g, adbSNP:16996639
complement(6439)-g, adbSNP:189775203
complement(6508)-g, cdbSNP:11549908
complement(6514)-t, cdbSNP:184405957
complement(6534)-g, adbSNP:191310715
complement(6537)-g, adbSNP:187906538
complement(6588)-g, adbSNP:55979529
complement(6589)-t, cdbSNP:149773047
complement(6703)-t, cdbSNP:116572976
complement(6710)-t, cdbSNP:136200
complement(6772)-t, cdbSNP:1056049
complement(6800)-g, adbSNP:55994070
complement(6803)-, gdbSNP:35347691
complement(6818)-g, cdbSNP:184752589
complement(6846)-t, cdbSNP:12107
complement(6914)-t, cdbSNP:7078
complement(7020)-c, adbSNP:192511111
complement(7099)-g, adbSNP:11549912
complement(7133)-c, adbSNP:112039601
complement(7263..7264)-g, adbSNP:11549911
complement(7274)-, adbSNP:56058205
complement(7288)-g, adbSNP:188489592
complement(7318)-t, adbSNP:56360445
complement(7343)-g, cdbSNP:5995275
complement(7359)-t, cdbSNP:183604549
complement(7382)-c, adbSNP:3205191
complement(7385)-g, adbSNP:191256255
complement(7414)-t, cdbSNP:8226
complement(7428)-t, cdbSNP:2481
complement(7443)-g, adbSNP:146582828
complement(7501)-t, adbSNP:111959795
Gene SymbolMYH9
Gene SynonymBDPLT6; DFNA17; EPSTS; FTNS; MHA; NMHC-II-A; NMMHC-IIA; NMMHCA
Chromosome22
Locus Map22q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002473 Homo sapiens myosin, heavy chain 9, non-muscle (MYH9), mRNA. On-demand $2699.00 30
Title Clinical, pathological, and genetic analysis of ten patients with MYH9-related disease .
Author Sun,X.H., Wang,Z.Y., Yang,H.Y., Cao,L.J., Su,J., Yu,Z.Q., Bai,X. and Ruan,C.G.
Journal Acta Haematol. 129 (2), 106-113 (2013)
Title Crawling from soft to stiff matrix polarizes the cytoskeleton and phosphoregulates myosin-II heavy chain .
Author Raab,M., Swift,J., Dingal,P.C., Shah,P., Shin,J.W. and Discher,D.E.
Journal J. Cell Biol. 199 (4), 669-683 (2012)
Title MYBPH inhibits NM IIA assembly via direct interaction with NMHC IIA and reduces cell motility .
Author Hosono,Y., Usukura,J., Yamaguchi,T., Yanagisawa,K., Suzuki,M. and Takahashi,T.
Journal Biochem. Biophys. Res. Commun. 428 (1), 173-178 (2012)
Title Sulfiredoxin redox-sensitive interaction with S100A4 and non-muscle myosin IIA regulates cancer cell motility .
Author Bowers,R.R., Manevich,Y., Townsend,D.M. and Tew,K.D.
Journal Biochemistry 51 (39), 7740-7754 (2012)
Title [Clinical manifestations and gene mutations of a Chinese family with MYH9-related syndrome] .
Author Shi,R.M., Cao,X.Q., Luo,S.F., Fang,X.L., Wang,R.H. and Liu,Z.G.
Journal Zhongguo Dang Dai Er Ke Za Zhi 14 (9), 678-682 (2012)
Title Cellular myosin heavy chain in human leukocytes: isolation of 5' cDNA clones, characterization of the protein, chromosomal localization, and upregulation during myeloid differentiation .
Author Toothaker,L.E., Gonzalez,D.A., Tung,N., Lemons,R.S., Le Beau,M.M., Arnaout,M.A., Clayton,L.K. and Tenen,D.G.
Journal Blood 78 (7), 1826-1833 (1991)
Title Human nonmuscle myosin heavy chains are encoded by two genes located on different chromosomes .
Author Simons,M., Wang,M., McBride,O.W., Kawamoto,S., Yamakawa,K., Gdula,D., Adelstein,R.S. and Weir,L.
Journal Circ. Res. 69 (2), 530-539 (1991)
Title Human nonmuscle myosin heavy chain mRNA: generation of diversity through alternative polyadenylylation .
Author Saez,C.G., Myers,J.C., Shows,T.B. and Leinwand,L.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (3), 1164-1168 (1990)
Title Effect of C-protein on actomyosin ATPase .
Author Moos,C. and Feng,I.N.
Journal Biochim. Biophys. Acta 632 (2), 141-149 (1980)
Title The interaction of C-protein with heavy meromyosin and subfragment-2 .
Author Starr,R. and Offer,G.
Journal Biochem. J. 171 (3), 813-816 (1978)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.