• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nerve growth factor (beta polypeptide) (NGF), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002506 Homo sapiens nerve growth factor (beta polypeptide) (NGF), mRNA. GenEZ ORF Cloning On-demand $399.00 14

*Business Day

Related Services

RefSeq Version NM_002506.2, 70995318
Length 1052 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens nerve growth factor (beta polypeptide) (NGF), mRNA.
Product beta-nerve growth factor precursor
Comment

Summary: This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq, Jul 2008].

RefSeq NP_002497.2
CDS 170..895
Misc Feature(1)419..421
Misc Feature(2)542..886
Exon (1)1..33
Gene:NGF
Gene Synonym:Beta-NGF; HSAN5; NGFB
Exon (2)34..157
Gene:NGF
Gene Synonym:Beta-NGF; HSAN5; NGFB
Exon (3)158..1049
Gene:NGF
Gene Synonym:Beta-NGF; HSAN5; NGFB
Translation MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIA ARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSK RSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR DPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRR A
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(74)-t, gdbSNP:61730971
complement(163)-dbSNP:
complement(163)-g, adbSNP:376149287
complement(187)-g, adbSNP:370169329
complement(212)-t, g, cdbSNP:181255687
complement(223)-g, adbSNP:6325
complement(247)-g, adbSNP:150188752
273+c, tdbSNP:6330
complement(275)-g, adbSNP:267597943
complement(308)-c, adbSNP:185385214
complement(309)-g, adbSNP:181709715
complement(314)-g, adbSNP:146716262
complement(324)-t, c, adbSNP:149054069
complement(328)-g, adbSNP:376241395
complement(329)-t, cdbSNP:200459956
complement(334)-t, cdbSNP:149876217
complement(342)-g, adbSNP:201861727
complement(343)-t, cdbSNP:147326889
complement(354)-t, cdbSNP:369266810
complement(360)-g, adbSNP:201087374
complement(372)-t, cdbSNP:377253859
complement(376)-g, adbSNP:372994894
complement(383)-t, cdbSNP:386518339
complement(383)-g, adbSNP:11466110
complement(393)-t, cdbSNP:141486298
complement(408)-g, adbSNP:11466111
complement(416)-g, adbSNP:138175552
complement(420)-g, adbSNP:267597942
complement(426)-t, cdbSNP:200629339
complement(445)-t, cdbSNP:202060337
complement(453)-t, cdbSNP:150136942
complement(468)-g, adbSNP:142538674
complement(478)-c, adbSNP:372694067
complement(490)-g, adbSNP:202005277
complement(491)-t, cdbSNP:145894043
complement(504)-g, cdbSNP:147763877
complement(505)-g, adbSNP:35941329
complement(512)-t, cdbSNP:376618971
complement(539)-t, adbSNP:145691700
complement(548)-t, gdbSNP:28758211
complement(550)-g, adbSNP:372985633
complement(586)-g, adbSNP:369555032
complement(588)-t, cdbSNP:201867223
complement(590)-t, g, cdbSNP:199511298
complement(608..609)-, ggttdbSNP:370724679
complement(611)-c, adbSNP:202138909
complement(614)-t, cdbSNP:149823633
complement(635)-t, cdbSNP:369927492
complement(651)-g, cdbSNP:139830389
complement(677)-g, adbSNP:139541754
complement(681)-t, cdbSNP:375808064
complement(722)-t, cdbSNP:141889164
complement(725)-t, cdbSNP:201152024
complement(778)-t, cdbSNP:143157422
complement(799)-t, cdbSNP:112292538
complement(814)-g, adbSNP:371529651
complement(825)-g, cdbSNP:371216746
complement(830)-g, adbSNP:386518340
836+a, tdbSNP:80277627
complement(846)-t, cdbSNP:34542615
complement(864..865)-, cadbSNP:142696332
complement(892)-g, adbSNP:34079702
complement(906)-g, adbSNP:199812295
Gene SymbolNGF
Gene SynonymBeta-NGF; HSAN5; NGFB
Chromosome1
Locus Map1p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002506 Homo sapiens nerve growth factor (beta polypeptide) (NGF), mRNA. On-demand $399.00 14
XM_006710663 PREDICTED: Homo sapiens nerve growth factor (beta polypeptide) (NGF), transcript variant X1, mRNA. On-demand $399.00 14
XM_006710664 PREDICTED: Homo sapiens nerve growth factor (beta polypeptide) (NGF), transcript variant X2, mRNA. On-demand $399.00 14
XM_006710665 PREDICTED: Homo sapiens nerve growth factor (beta polypeptide) (NGF), transcript variant X3, mRNA. On-demand $399.00 14
Title Urinary NGF, TGF-beta1, TIMP-2 and bladder wall thickness predict neurourological findings in children with myelodysplasia .
Author Sekerci CA, Isbilen B, Isman F, Akbal C, Simsek F and Tarcan T.
Journal J. Urol. 191 (1), 199-205 (2014)
Title Increased circulating levels of neurotrophins and elevated expression of their high-affinity receptors on skin and gut mast cells in mastocytosis .
Author Peng WM, Maintz L, Allam JP, Raap U, Gutgemann I, Kirfel J, Wardelmann E, Perner S, Zhao W, Fimmers R, Walgenbach K, Oldenburg J, Schwartz LB and Novak N.
Journal Blood 122 (10), 1779-1788 (2013)
Title Rac1 mediates load-driven attenuation of mRNA expression of nerve growth factor beta in cartilage and chondrocytes .
Author Shim JW, Hamamura K, Chen A, Wan Q, Na S and Yokota H.
Journal J Musculoskelet Neuronal Interact 13 (3), 372-379 (2013)
Title Hypertrophy of neurons within cardiac ganglia in human, canine, and rat heart failure: the potential role of nerve growth factor .
Author Singh S, Sayers S, Walter JS, Thomas D, Dieter RS, Nee LM and Wurster RD.
Journal J Am Heart Assoc 2 (4), E000210 (2013)
Title Dependence receptor UNC5D mediates nerve growth factor depletion-induced neuroblastoma regression .
Author Zhu Y, Li Y, Haraguchi S, Yu M, Ohira M, Ozaki T, Nakagawa A, Ushijima T, Isogai E, Koseki H, Nakamura Y, Kong C, Mehlen P, Arakawa H and Nakagawara A.
Journal J. Clin. Invest. 123 (7), 2935-2947 (2013)
Title Expression of nerve growth factor and nerve growth factor receptor genes in human tissues and in prostatic adenocarcinoma cell lines .
Author MacGrogan D, Saint-Andre JP and Dicou E.
Journal J. Neurochem. 59 (4), 1381-1391 (1992)
Title Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary .
Author Hallbook F, Ibanez CF and Persson H.
Journal Neuron 6 (5), 845-858 (1991)
Title cDNA sequence of human beta-NGF .
Author Borsani G, Pizzuti A, Rugarli EI, Falini A, Silani V, Sidoli A, Scarlato G and Baralle FE.
Journal Nucleic Acids Res. 18 (13), 4020 (1990)
Title Mapping the human amylase gene cluster on the proximal short arm of chromosome 1 using a highly informative (CA)n repeat .
Author Dracopoli NC and Meisler MH.
Journal Genomics 7 (1), 97-102 (1990)
Title Two thyroid hormone regulated genes, the beta-subunits of nerve growth factor (NGFB) and thyroid stimulating hormone (TSHB), are located less than 310 kb apart in both human and mouse genomes .
Author Dracopoli NC, Rose E, Whitfield GK, Guidon PT Jr, Bale SJ, Chance PA, Kourides IA and Housman DE.
Journal Genomics 3 (2), 161-167 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.