• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nerve growth factor (beta polypeptide) (NGF), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002506 Homo sapiens nerve growth factor (beta polypeptide) (NGF), mRNA. GenEZ ORF Cloning On-demand $399.00 14

*Business Day

Related Services

RefSeq Version NM_002506.2, 70995318
Length 1052 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens nerve growth factor (beta polypeptide) (NGF), mRNA.
Product beta-nerve growth factor precursor
Comment

Summary: This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq, Jul 2008].

RefSeq NP_002497.2
CDS 170..895
Misc Feature(1)419..421
Misc Feature(2)542..886
Exon (1)1..33
Gene:NGF
Gene Synonym:Beta-NGF; HSAN5; NGFB
Exon (2)34..157
Gene:NGF
Gene Synonym:Beta-NGF; HSAN5; NGFB
Exon (3)158..1049
Gene:NGF
Gene Synonym:Beta-NGF; HSAN5; NGFB
Translation MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIA ARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSK RSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR DPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRR A
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(74)-t, gdbSNP:61730971
complement(212)-t, g, cdbSNP:181255687
complement(223)-g, adbSNP:6325
complement(247)-g, adbSNP:150188752
complement(273)-t, cdbSNP:6330
complement(308)-c, adbSNP:185385214
complement(309)-g, adbSNP:181709715
complement(314)-g, adbSNP:146716262
complement(324)-t, c, adbSNP:149054069
complement(329)-t, cdbSNP:200459956
complement(334)-t, cdbSNP:149876217
complement(342)-g, adbSNP:201861727
complement(343)-t, cdbSNP:147326889
complement(360)-g, adbSNP:201087374
complement(383)-g, adbSNP:11466110
complement(393)-t, cdbSNP:141486298
complement(408)-g, adbSNP:11466111
complement(416)-g, adbSNP:138175552
complement(421)-t, adbSNP:140381417
complement(426)-t, cdbSNP:200629339
complement(445)-t, cdbSNP:202060337
complement(453)-t, cdbSNP:150136942
complement(468)-g, adbSNP:142538674
complement(490)-g, adbSNP:202005277
complement(491)-t, cdbSNP:145894043
complement(504)-g, cdbSNP:147763877
complement(505)-g, adbSNP:35941329
complement(539)-t, adbSNP:145691700
complement(548)-t, gdbSNP:28758211
complement(588)-t, cdbSNP:201867223
complement(590)-g, cdbSNP:199511298
complement(611)-c, adbSNP:202138909
complement(614)-t, cdbSNP:149823633
complement(651)-g, cdbSNP:139830389
complement(677)-g, adbSNP:139541754
complement(722)-t, cdbSNP:141889164
complement(725)-t, cdbSNP:201152024
complement(778)-t, cdbSNP:143157422
complement(799)-t, cdbSNP:112292538
complement(830)-t, cdbSNP:11466112
complement(836)-t, adbSNP:80277627
complement(846)-t, cdbSNP:34542615
complement(864..865)-, cadbSNP:142696332
complement(892)-g, adbSNP:34079702
complement(906)-g, adbSNP:199812295
Gene SymbolNGF
Gene SynonymBeta-NGF; HSAN5; NGFB
Chromosome1
Locus Map1p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002506 Homo sapiens nerve growth factor (beta polypeptide) (NGF), mRNA. On-demand $399.00 14
Title [Levels of nerve growth factor and interleukin-4 in the induced sputum of children with cough variant asthma] .
Author Li,H.Z., Jin,Z.Y., Yuan,X.Z. and Jin,C.J.
Journal Zhongguo Dang Dai Er Ke Za Zhi 14 (12), 924-927 (2012)
Title ProNGF, a cytokine induced after myocardial infarction in humans, targets pericytes to promote microvascular damage and activation .
Author Siao,C.J., Lorentz,C.U., Kermani,P., Marinic,T., Carter,J., McGrath,K., Padow,V.A., Mark,W., Falcone,D.J., Cohen-Gould,L., Parrish,D.C., Habecker,B.A., Nykjaer,A., Ellenson,L.H., Tessarollo,L. and Hempstead,B.L.
Journal J. Exp. Med. 209 (12), 2291-2305 (2012)
Title Hippocampal proNGF signaling pathways and beta-amyloid levels in mild cognitive impairment and Alzheimer disease .
Author Mufson,E.J., He,B., Nadeem,M., Perez,S.E., Counts,S.E., Leurgans,S., Fritz,J., Lah,J., Ginsberg,S.D., Wuu,J. and Scheff,S.W.
Journal J. Neuropathol. Exp. Neurol. 71 (11), 1018-1029 (2012)
Title Nerve growth factor and brain-derived neurotrophic factor concentrations in schizophrenia: a review .
Author Martinotti,G., Di Iorio,G., Marini,S., Ricci,V., De Berardis,D. and Di Giannantonio,M.
Journal J. Biol. Regul. Homeost. Agents 26 (3), 347-356 (2012)
Title Increased urine and serum nerve growth factor levels in interstitial cystitis suggest chronic inflammation is involved in the pathogenesis of disease .
Author Liu,H.T. and Kuo,H.C.
Journal PLoS ONE 7 (9), E44687 (2012)
Title Expression of nerve growth factor and nerve growth factor receptor genes in human tissues and in prostatic adenocarcinoma cell lines .
Author MacGrogan,D., Saint-Andre,J.P. and Dicou,E.
Journal J. Neurochem. 59 (4), 1381-1391 (1992)
Title Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary .
Author Hallbook,F., Ibanez,C.F. and Persson,H.
Journal Neuron 6 (5), 845-858 (1991)
Title cDNA sequence of human beta-NGF .
Author Borsani,G., Pizzuti,A., Rugarli,E.I., Falini,A., Silani,V., Sidoli,A., Scarlato,G. and Baralle,F.E.
Journal Nucleic Acids Res. 18 (13), 4020 (1990)
Title Mapping the human amylase gene cluster on the proximal short arm of chromosome 1 using a highly informative (CA)n repeat .
Author Dracopoli,N.C. and Meisler,M.H.
Journal Genomics 7 (1), 97-102 (1990)
Title Two thyroid hormone regulated genes, the beta-subunits of nerve growth factor (NGFB) and thyroid stimulating hormone (TSHB), are located less than 310 kb apart in both human and mouse genomes .
Author Dracopoli,N.C., Rose,E., Whitfield,G.K., Guidon,P.T. Jr., Bale,S.J., Chance,P.A., Kourides,I.A. and Housman,D.E.
Journal Genomics 3 (2), 161-167 (1988)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.