• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002520 Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_002520.6, 262331543
Length 1449 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1, mRNA.
Product nucleophosmin isoform 1
Comment

Summary: This gene encodes a phosphoprotein which moves between the nucleus and the cytoplasm. The gene product is thought to be involved in several processes including regulation of the ARF/p53 pathway. A number of genes are fusion partners have been characterized, in particular the anaplastic lymphoma kinase gene on chromosome 2. Mutations in this gene are associated with acute myeloid leukemia. More than a dozen pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Nov 2009].


Transcript Variant: This predominant variant (1) represents the longest transcript and encodes the longest isoform (1).

RefSeq NP_002511.1
CDS 246..1130
Misc Feature(1)246..803
Misc Feature(2)246..803
Misc Feature(3)246..596
Misc Feature(4)246..248
Misc Feature(5)255..257
Misc Feature(6)255..257
Misc Feature(7)273..275
Misc Feature(8)273..275
Misc Feature(9)282..>593
Misc Feature(10)339..341
Misc Feature(11)408..410
Misc Feature(12)444..446
Misc Feature(13)453..455
Misc Feature(14)453..455
Misc Feature(15)453..455
Misc Feature(16)468..470
Misc Feature(17)483..485
Misc Feature(18)528..530
Misc Feature(19)528..530
Misc Feature(20)618..620
Misc Feature(21)618..620
Misc Feature(22)618..620
Misc Feature(23)654..656
Misc Feature(24)660..662
Misc Feature(25)693..695
Misc Feature(26)699..716
Misc Feature(27)705..707
Misc Feature(28)768..773
Misc Feature(29)816..836
Misc Feature(30)840..842
Misc Feature(31)840..842
Misc Feature(32)879..881
Misc Feature(33)900..902
Misc Feature(34)900..902
Misc Feature(35)924..926
Misc Feature(36)930..932
Misc Feature(37)933..935
Misc Feature(38)945..947
Misc Feature(39)945..947
Misc Feature(40)954..956
Misc Feature(41)954..956
Misc Feature(42)969..971
Misc Feature(43)972..1127
Misc Feature(44)972..974
Misc Feature(45)993..995
Misc Feature(46)1005..1007
Misc Feature(47)1005..1007
Misc Feature(48)1005..1007
Misc Feature(49)1014..1016
Misc Feature(50)1023..1025
Misc Feature(51)1044..1046
Misc Feature(52)1062..1064
Misc Feature(53)1080..1082
Misc Feature(54)1119..1121
Exon (1)1..303
Gene:NPM1
Gene Synonym:B23; NPM
Exon (2)304..383
Gene:NPM1
Gene Synonym:B23; NPM
Exon (3)384..503
Gene:NPM1
Gene Synonym:B23; NPM
Exon (4)504..597
Gene:NPM1
Gene Synonym:B23; NPM
Exon (5)598..704
Gene:NPM1
Gene Synonym:B23; NPM
Exon (6)705..769
Gene:NPM1
Gene Synonym:B23; NPM
Exon (7)770..827
Gene:NPM1
Gene Synonym:B23; NPM
Exon (8)828..914
Gene:NPM1
Gene Synonym:B23; NPM
Exon (9)915..1016
Gene:NPM1
Gene Synonym:B23; NPM
Exon (10)1017..1091
Gene:NPM1
Gene Synonym:B23; NPM
Exon (11)1092..1449
Gene:NPM1
Gene Synonym:B23; NPM
Translation MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDD FDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
49+dbSNP:
49+c, gdbSNP:75828148
138+c, gdbSNP:10069429
142+c, tdbSNP:148722569
147+c, tdbSNP:112023099
149+g, tdbSNP:112330400
170..171+a, gdbSNP:11551528
171+c, tdbSNP:28411385
182+c, tdbSNP:180887715
183..184+c, gdbSNP:11551579
183+c, gdbSNP:185295288
190+a, gdbSNP:189577643
192+c, tdbSNP:111426800
197+c, tdbSNP:11551555
198+c, tdbSNP:11551547
204+c, tdbSNP:11551556
210+c, tdbSNP:200132495
218+c, tdbSNP:202010899
221+c, tdbSNP:11551523
225+c, tdbSNP:35747006
232+c, tdbSNP:11551571
284+a, gdbSNP:142254256
312+dbSNP:
312+c, tdbSNP:35979859
422+dbSNP:
422+g, tdbSNP:142102985
436+c, tdbSNP:11551526
438+a, gdbSNP:11551576
446+c, tdbSNP:200294440
479+c, tdbSNP:11551522
481+c, tdbSNP:11551525
483+a, gdbSNP:17851944
502+c, tdbSNP:147806769
512..513+dbSNP:
512..513+g, tdbSNP:11551553
566+a, gdbSNP:201813873
596+a, gdbSNP:141086340
626+dbSNP:
626+c, tdbSNP:200558908
719+dbSNP:
719+c, tdbSNP:61749648
740+c, tdbSNP:146936311
743+c, tdbSNP:147629377
778+dbSNP:
778+a, gdbSNP:17856513
785+c, tdbSNP:140888436
788+c, tdbSNP:61755048
823+a, gdbSNP:183724988
860+dbSNP:
860+a, gdbSNP:201906545
969+dbSNP:
969+a, gdbSNP:138586088
978+c, gdbSNP:143209617
1007+a, tdbSNP:11551532
1057+dbSNP:
1057+a, gdbSNP:17851431
1067+c, tdbSNP:149305908
1104+dbSNP:
1104+c, tdbSNP:17850940
1141+c, tdbSNP:201083444
1153+a, tdbSNP:3209214
1159+a, gdbSNP:200638434
1166+a, gdbSNP:1059404
1219+a, gdbSNP:6859650
1258+a, cdbSNP:183613332
1264+c, gdbSNP:146200852
1295+, tdbSNP:34351976
1377+a, gdbSNP:1059683
1404+c, gdbSNP:139047811
Gene SymbolNPM1
Gene SynonymB23; NPM
Chromosome5
Locus Map5q35.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001037738 Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 3, mRNA. On-demand $449.00 14
NM_002520 Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1, mRNA. On-demand $449.00 14
NM_199185 Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 2, mRNA. On-demand $449.00 14
Title Whole-genome-amplified DNA as a source for mutational analysis underestimates the frequency of mutations in pediatric acute myeloid leukemia .
Author Rosenquist,R., Ehrencrona,H., Hasle,H., Palle,J. and Kanduri,M.
Journal Leukemia 27 (2), 510-512 (2013)
Title Refining the diagnosis and prognostic categorization of acute myeloid leukemia patients with an integrated use of cytogenetic and molecular studies .
Author Costa,D., Vidal,A., Carrio,A., Munoz,C., Arias,A., Gomez,C., Berneaga,D., Colomer,D., Rozman,M., Pratcorona,M., Torrebadell,M., Diaz-Beya,M., Esteve,J. and Campo,E.
Journal Acta Haematol. 129 (2), 65-71 (2013)
Title DDX31 regulates the p53-HDM2 pathway and rRNA gene transcription through its interaction with NPM1 in renal cell carcinomas .
Author Fukawa,T., Ono,M., Matsuo,T., Uehara,H., Miki,T., Nakamura,Y., Kanayama,H.O. and Katagiri,T.
Journal Cancer Res. 72 (22), 5867-5877 (2012)
Title PDGFR blockade is a rational and effective therapy for NPM-ALK-driven lymphomas .
Author Laimer,D., Dolznig,H., Kollmann,K., Vesely,P.W., Schlederer,M., Merkel,O., Schiefer,A.I., Hassler,M.R., Heider,S., Amenitsch,L., Thallinger,C., Staber,P.B., Simonitsch-Klupp,I., Artaker,M., Lagger,S., Turner,S.D., Pileri,S., Piccaluga,P.P., Valent,P., Messana,K., Landra,I., Weichhart,T., Knapp,S., Shehata,M., Todaro,M., Sexl,V., Hofler,G., Piva,R., Medico,E., Ruggeri,B.A., Cheng,M., Eferl,R., Egger,G., Penninger,J.M., Jaeger,U., Moriggl,R., Inghirami,G. and Kenner,L.
Journal Nat. Med. 18 (11), 1699-1704 (2012)
Title Detection of cytoplasmic nucleophosmin expression by imaging flow cytometry .
Author Grimwade,L., Gudgin,E., Bloxham,D., Bottley,G., Vassiliou,G., Huntly,B., Scott,M.A. and Erber,W.N.
Journal Cytometry A 81 (10), 896-900 (2012)
Title Specific complex of human immunodeficiency virus type 1 rev and nucleolar B23 proteins: dissociation by the Rev response element .
Author Fankhauser,C., Izaurralde,E., Adachi,Y., Wingfield,P. and Laemmli,U.K.
Journal Mol. Cell. Biol. 11 (5), 2567-2575 (1991)
Title Functional domains of the HIV-1 rev gene required for trans-regulation and subcellular localization .
Author Venkatesh,L.K., Mohammed,S. and Chinnadurai,G.
Journal Virology 176 (1), 39-47 (1990)
Title Identification of sequences important in the nucleolar localization of human immunodeficiency virus Rev: relevance of nucleolar localization to function .
Author Cochrane,A.W., Perkins,A. and Rosen,C.A.
Journal J. Virol. 64 (2), 881-885 (1990)
Title Isolation and characterization of a molecular cDNA clone of a human mRNA from interferon-treated cells encoding nucleolar protein B23, numatrin .
Author Zhang,X.X., Thomis,D.C. and Samuel,C.E.
Journal Biochem. Biophys. Res. Commun. 164 (1), 176-184 (1989)
Title Amino acid sequence of a specific antigenic peptide of protein B23 .
Author Chan,P.K., Chan,W.Y., Yung,B.Y., Cook,R.G., Aldrich,M.B., Ku,D., Goldknopf,I.L. and Busch,H.
Journal J. Biol. Chem. 261 (30), 14335-14341 (1986)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.