• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002546 Homo sapiens tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_002546.3, 148743792
Length 2354 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), mRNA.
Product tumor necrosis factor receptor superfamily member 11B precursor
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined. [provided by RefSeq, Jul 2008].

RefSeq NP_002537.3
CDS 324..1529
Misc Feature(1)192..194
Misc Feature(2)257
Misc Feature(3)393..509
Misc Feature(4)405..695
Misc Feature(5)order(405..410,531..533,564..566,594..596,675..677)
Misc Feature(6)order(417..419,447..449,459..461,465..467,504..506,
Misc Feature(7)order(447..476,501..515,615..623)
Misc Feature(8)516..638
Misc Feature(9)order(540..545,561..569)
Misc Feature(10)642..749
Misc Feature(11)693..>878
Misc Feature(12)order(693..716,741..755,855..863)
Misc Feature(13)order(699..701,705..707,744..746,753..755,783..785)
Misc Feature(14)756..878
Misc Feature(15)order(780..785,801..809)
Misc Feature(16)1200..1418
Misc Feature(17)1521..1523
Exon (1)1..353
Gene:TNFRSF11B
Gene Synonym:OCIF; OPG; TR1
Exon (2)354..723
Gene:TNFRSF11B
Gene Synonym:OCIF; OPG; TR1
Exon (3)724..915
Gene:TNFRSF11B
Gene Synonym:OCIF; OPG; TR1
Exon (4)916..1140
Gene:TNFRSF11B
Gene Synonym:OCIF; OPG; TR1
Exon (5)1141..2346
Gene:TNFRSF11B
Gene Synonym:OCIF; OPG; TR1
Translation MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKT VCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLK HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNAT HDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI KRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLME SLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKT VTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(16)-dbSNP:
complement(16)-g, cdbSNP:113561777
complement(26)-c, adbSNP:11575930
complement(40)-t, cdbSNP:11575929
complement(101)-t, cdbSNP:2073617
complement(124)-c, adbSNP:11573807
complement(292)-c, adbSNP:1050927
complement(316)-t, cdbSNP:199763003
complement(332)-g, cdbSNP:2073618
complement(370)-dbSNP:
complement(370)-g, adbSNP:149667027
complement(382)-g, adbSNP:140846266
complement(392)-t, cdbSNP:146450643
complement(409)-g, adbSNP:144062067
complement(419)-g, adbSNP:4876870
complement(420)-g, cdbSNP:202090603
complement(427)-t, gdbSNP:150777320
complement(509)-g, adbSNP:142201380
complement(510)-t, cdbSNP:116321565
complement(549)-t, cdbSNP:200071478
complement(557)-g, adbSNP:144654126
complement(575)-g, adbSNP:199830002
complement(583)-g, adbSNP:104894091
complement(633)-g, adbSNP:11573906
complement(654)-t, gdbSNP:201167408
complement(655)-t, cdbSNP:200629343
complement(672)-t, cdbSNP:104894092
complement(699)-t, gdbSNP:149349985
complement(784)-dbSNP:
complement(784)-g, adbSNP:149778739
complement(806)-t, cdbSNP:140021481
complement(851)-t, cdbSNP:200748751
complement(866)-g, adbSNP:146588847
complement(875)-t, cdbSNP:143929985
complement(881)-t, cdbSNP:11573923
complement(1022)-dbSNP:
complement(1022)-g, adbSNP:150457771
complement(1023)-t, cdbSNP:201393730
complement(1037)-g, adbSNP:11573930
complement(1072)-g, adbSNP:199810725
complement(1091)-g, adbSNP:2228568
complement(1106)-g, c, adbSNP:61761330
complement(1111)-c, adbSNP:1131380
complement(1162)-dbSNP:
complement(1162)-t, cdbSNP:201748894
complement(1163)-g, adbSNP:143414212
complement(1164)-t, cdbSNP:140782326
complement(1208)-t, adbSNP:11573942
complement(1209)-g, adbSNP:145316984
complement(1280)-g, adbSNP:140297643
complement(1306)-g, adbSNP:200218935
complement(1316)-t, gdbSNP:1804853
complement(1321)-t, cdbSNP:145544246
complement(1323)-t, cdbSNP:200140054
complement(1407)-t, cdbSNP:201475481
complement(1413)-t, cdbSNP:201965016
complement(1425)-t, adbSNP:149720389
complement(1434)-c, adbSNP:34353469
complement(1473)-t, cdbSNP:1804854
complement(1505)-t, cdbSNP:151008182
complement(1551)-t, cdbSNP:11573943
complement(1569)-t, cdbSNP:200332093
complement(1596)-t, cdbSNP:11573944
complement(1786)-t, adbSNP:186535296
complement(1798)-c, adbSNP:183331643
complement(1811..1812)-, tdbSNP:112977670
complement(1822)-g, adbSNP:3134039
complement(1825)-t, gdbSNP:3094021
complement(1866)-t, cdbSNP:3134038
complement(1871)-g, adbSNP:3134037
complement(1896)-t, cdbSNP:7815884
complement(1901)-c, adbSNP:11573945
complement(1942)-t, gdbSNP:186788358
complement(1986)-t, gdbSNP:3094022
complement(2056)-g, adbSNP:11573946
complement(2074)-t, cdbSNP:11573947
complement(2112)-t, adbSNP:7815440
complement(2211)-g, adbSNP:189721016
complement(2217)-g, adbSNP:143388345
complement(2241)-g, adbSNP:11573948
Gene SymbolTNFRSF11B
Gene SynonymOCIF; OPG; TR1
Chromosome8
Locus Map8q24
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002546 Homo sapiens tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), mRNA. In-stock $418.00 $369.00 10
Title Expression of osteoprotegerin from a replicating adenovirus inhibits the progression of prostate cancer bone metastases in a murine model .
Author Cody,J.J., Rivera,A.A., Lyons,G.R., Yang,S.W., Wang,M., Ashley,J.W., Meleth,S., Feng,X., Siegal,G.P. and Douglas,J.T.
Journal Lab. Invest. 93 (3), 268-278 (2013)
Title Role of GSH/GSSG redox couple in osteogenic activity and osteoclastogenic markers of human osteoblast-like SaOS-2 cells .
Author Romagnoli,C., Marcucci,G., Favilli,F., Zonefrati,R., Mavilia,C., Galli,G., Tanini,A., Iantomasi,T., Brandi,M.L. and Vincenzini,M.T.
Journal FEBS J. 280 (3), 867-879 (2013)
Title Protein phosphatase 2A Calpha is involved in osteoclastogenesis by regulating RANKL and OPG expression in osteoblasts .
Author Okamura,H., Yang,D., Yoshida,K. and Haneji,T.
Journal FEBS Lett. 587 (1), 48-53 (2013)
Title Change of plasma osteoprotegerin and its association with endothelial dysfunction before and after exercise in Hashimoto's thyroiditis with euthyroidism .
Author Xiang,G., Xiang,L., Xiang,L., Wang,H. and Dong,J.
Journal Exp. Clin. Endocrinol. Diabetes 120 (9), 529-534 (2012)
Title Analysis of osteoprotegerin (OPG) gene polymorphism in Iranian patients with chronic periodontitis and peri-implantitis. A cross-sectional study .
Author Kadkhodazadeh,M., Tabari,Z.A., Ardakani,M.R., Ebadian,A.R. and Brook,A.
Journal Eur J Oral Implantol 5 (4), 381-388 (2012)
Title Characterization of monomeric and homodimeric forms of osteoclastogenesis inhibitory factor .
Author Tomoyasu,A., Goto,M., Fujise,N., Mochizuki,S., Yasuda,H., Morinaga,T., Tsuda,E. and Higashio,K.
Journal Biochem. Biophys. Res. Commun. 245 (2), 382-387 (1998)
Title Characterization of structural domains of human osteoclastogenesis inhibitory factor .
Author Yamaguchi,K., Kinosaki,M., Goto,M., Kobayashi,F., Tsuda,E., Morinaga,T. and Higashio,K.
Journal J. Biol. Chem. 273 (9), 5117-5123 (1998)
Title Characterization of a novel TNF-like ligand and recently described .
Author Tan,K.B., Harrop,J., Reddy,M., Young,P., Terrett,J., Emery,J., Moore,G. and Truneh,A.
Journal Gene 204 (1-2), 35-46 (1997)
Title Isolation of a novel cytokine from human fibroblasts that specifically inhibits osteoclastogenesis .
Author Tsuda,E., Goto,M., Mochizuki,S., Yano,K., Kobayashi,F., Morinaga,T. and Higashio,K.
Journal Biochem. Biophys. Res. Commun. 234 (1), 137-142 (1997)
Title Osteoprotegerin: a novel secreted protein involved in the regulation of bone density .
Author Simonet,W.S., Lacey,D.L., Dunstan,C.R., Kelley,M., Chang,M.S., Luthy,R., Nguyen,H.Q., Wooden,S., Bennett,L., Boone,T., Shimamoto,G., DeRose,M., Elliott,R., Colombero,A., Tan,H.L., Trail,G., Sullivan,J., Davy,E., Bucay,N., Renshaw-Gegg,L., Hughes,T.M., Hill,D., Pattison,W., Campbell,P., Sander,S., Van,G., Tarpley,J., Derby,P., Lee,R. and Boyle,W.J.
Journal Cell 89 (2), 309-319 (1997)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.