• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23879 Homo sapiens tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu23879C Homo sapiens tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002546.3, 148743792
Length 1206 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), mRNA.
Product tumor necrosis factor receptor superfamily member 11B precursor
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined. [provided by RefSeq, Jul 2008].

RefSeq NP_002537.3
CDS 324..1529
Misc Feature(1)192..194
Misc Feature(2)257
Misc Feature(3)393..509
Misc Feature(4)405..695
Misc Feature(5)order(405..410,531..533,564..566,594..596,675..677)
Misc Feature(6)order(417..419,447..449,459..461,465..467,504..506,
Misc Feature(7)order(447..476,501..515,615..623)
Misc Feature(8)516..638
Misc Feature(9)order(540..545,561..569)
Misc Feature(10)642..>878
Misc Feature(11)order(642..647,771..773,804..806,834..836)
Misc Feature(12)642..749
Misc Feature(13)order(654..656,681..683,699..701,705..707,744..746,
Misc Feature(14)order(681..683,690..716,741..755,855..863)
Misc Feature(15)756..878
Misc Feature(16)order(780..785,801..809)
Misc Feature(17)<1290..1382
Misc Feature(18)1521..1523
Exon (1)1..353
Gene:TNFRSF11B
Gene Synonym:OCIF; OPG; TR1
Exon (2)354..723
Gene:TNFRSF11B
Gene Synonym:OCIF; OPG; TR1
Exon (3)724..915
Gene:TNFRSF11B
Gene Synonym:OCIF; OPG; TR1
Exon (4)916..1140
Gene:TNFRSF11B
Gene Synonym:OCIF; OPG; TR1
Exon (5)1141..2346
Gene:TNFRSF11B
Gene Synonym:OCIF; OPG; TR1
Translation MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKT VCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLK HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNAT HDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI KRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLME SLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKT VTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(16)-dbSNP:
complement(16)-g, cdbSNP:113561777
26+a, cdbSNP:11575930
40+c, tdbSNP:11575929
complement(67)-c, adbSNP:368831724
101+c, tdbSNP:2073617
124+a, cdbSNP:11573807
complement(124)-t, gdbSNP:386519917
complement(231)-t, cdbSNP:369999091
292+a, cdbSNP:1050927
complement(316)-t, cdbSNP:199763003
332+c, gdbSNP:2073618
complement(344)-g, adbSNP:373330021
complement(346)-g, adbSNP:376517108
complement(382)-dbSNP:
complement(382)-g, adbSNP:140846266
complement(392)-t, cdbSNP:146450643
complement(409)-g, adbSNP:144062067
complement(419)-g, adbSNP:4876870
complement(420)-g, cdbSNP:202090603
complement(427)-t, gdbSNP:150777320
complement(509)-g, adbSNP:142201380
complement(510)-t, cdbSNP:116321565
complement(549)-t, cdbSNP:200071478
complement(557)-g, adbSNP:144654126
complement(575)-g, adbSNP:199830002
complement(579)-t, cdbSNP:371566584
583+a, gdbSNP:104894091
complement(600)-t, cdbSNP:369646136
complement(631)-t, cdbSNP:375274060
complement(632)-g, adbSNP:372009662
complement(633)-t, cdbSNP:386519924
complement(633)-g, adbSNP:11573906
complement(654)-t, gdbSNP:201167408
complement(655)-t, cdbSNP:200629343
672+c, tdbSNP:104894092
complement(685)-t, cdbSNP:370759767
complement(699)-t, gdbSNP:149349985
complement(784)-dbSNP:
complement(784)-g, adbSNP:149778739
complement(806)-t, cdbSNP:140021481
complement(851)-t, cdbSNP:200748751
complement(858)-t, cdbSNP:370819355
complement(866)-g, adbSNP:146588847
complement(881)-t, cdbSNP:11573923
complement(882)-t, cdbSNP:372458728
complement(944)-dbSNP:
complement(944)-g, adbSNP:376708982
complement(971)-t, cdbSNP:371614996
complement(1022)-g, adbSNP:150457771
complement(1023)-t, cdbSNP:201393730
complement(1037)-g, adbSNP:11573930
complement(1052)-t, adbSNP:374594601
complement(1072)-g, adbSNP:199810725
complement(1089)-c, adbSNP:368397401
complement(1091)-g, adbSNP:2228568
1106+a, c, gdbSNP:61761330
1111+a, cdbSNP:1131380
complement(1154)-dbSNP:
complement(1154)-g, adbSNP:368019227
complement(1162)-t, cdbSNP:201748894
complement(1163)-g, adbSNP:143414212
complement(1164)-t, cdbSNP:140782326
complement(1176)-t, cdbSNP:373848556
complement(1208)-t, adbSNP:11573942
complement(1209)-g, adbSNP:145316984
complement(1231)-g, adbSNP:370157044
complement(1258)-g, adbSNP:376914808
complement(1280)-g, adbSNP:140297643
complement(1306)-g, adbSNP:200218935
1316+g, tdbSNP:1804853
complement(1321)-t, cdbSNP:145544246
complement(1323)-t, cdbSNP:200140054
complement(1407)-t, cdbSNP:201475481
complement(1413)-t, cdbSNP:201965016
complement(1425)-t, adbSNP:149720389
1434+a, cdbSNP:34353469
complement(1461)-g, adbSNP:373470752
complement(1473)-t, cdbSNP:1804854
complement(1505)-t, cdbSNP:151008182
complement(1551)-t, cdbSNP:11573943
complement(1569)-t, cdbSNP:200332093
complement(1596)-t, cdbSNP:11573944
complement(1596)-t, cdbSNP:386519927
complement(1726)-t, cdbSNP:376569300
complement(1786)-t, adbSNP:186535296
complement(1798)-c, adbSNP:183331643
complement(1811..1812)-, tdbSNP:112977670
complement(1822)-g, adbSNP:3134039
1825+g, tdbSNP:3094021
complement(1866)-t, cdbSNP:3134038
complement(1871)-g, adbSNP:3134037
complement(1896)-t, cdbSNP:7815884
complement(1901)-c, adbSNP:11573945
complement(1901)-c, adbSNP:386519928
complement(1942)-t, gdbSNP:186788358
1986+g, tdbSNP:3094022
complement(2053)-t, adbSNP:372828890
complement(2056)-g, adbSNP:11573946
complement(2056)-g, adbSNP:386519929
complement(2074)-t, cdbSNP:11573947
complement(2074)-g, adbSNP:386519930
complement(2112)-t, adbSNP:7815440
complement(2211)-g, adbSNP:189721016
complement(2217)-g, adbSNP:143388345
complement(2241)-t, cdbSNP:386519931
complement(2241)-g, adbSNP:11573948
Gene SymbolTNFRSF11B
Gene SynonymOCIF; OPG; TR1
Chromosome8
Locus Map8q24
Title Decreased affinity of recombinant human tumor necrosis factor-related apoptosis-inducing ligand (rhTRAIL) D269H/E195R to osteoprotegerin (OPG) overcomes TRAIL resistance mediated by the bone microenvironment .
Author Bosman MC, Reis CR, Schuringa JJ, Vellenga E and Quax WJ.
Journal J. Biol. Chem. 289 (2), 1071-1078 (2014)
Title Association between seven common OPG genetic polymorphisms and osteoporosis risk: a meta-analysis .
Author Guo L, Tang K, Quan Z, Zhao Z and Jiang D.
Journal DNA Cell Biol. 33 (1), 29-39 (2014)
Title Serum osteoprotegerin is associated with vascular stiffness and the onset of new cardiovascular events in hemodialysis patients .
Author Lee JE, Kim HJ, Moon SJ, Nam JS, Kim JK, Kim SK, Yun GY, Ha SK and Park HC.
Journal Korean J. Intern. Med. 28 (6), 668-677 (2013)
Title Osteoprotegerin contributes to the metastatic potential of cells with a dysfunctional TSC2 tumor-suppressor gene .
Author Steagall WK, Pacheco-Rodriguez G, Glasgow CG, Ikeda Y, Lin JP, Zheng G and Moss J.
Journal Am. J. Pathol. 183 (3), 938-950 (2013)
Title Comparison of osteoprotegerin and vascular endothelial growth factor in normoalbuminuric Type 1 diabetic and control subjects .
Author Esteghamati A, Arefzadeh A, Zandieh A, Salehi Sadaghiani M, Noshad
Journal J. Endocrinol. Invest. 36 (7), 474-477 (2013)
Title Characterization of monomeric and homodimeric forms of osteoclastogenesis inhibitory factor .
Author Tomoyasu A, Goto M, Fujise N, Mochizuki S, Yasuda H, Morinaga T, Tsuda E and Higashio K.
Journal Biochem. Biophys. Res. Commun. 245 (2), 382-387 (1998)
Title Characterization of structural domains of human osteoclastogenesis inhibitory factor .
Author Yamaguchi K, Kinosaki M, Goto M, Kobayashi F, Tsuda E, Morinaga T and Higashio K.
Journal J. Biol. Chem. 273 (9), 5117-5123 (1998)
Title Characterization of a novel TNF-like ligand and recently described .
Author Tan KB, Harrop J, Reddy M, Young P, Terrett J, Emery J, Moore G and Truneh A.
Journal Gene 204 (1-2), 35-46 (1997)
Title Isolation of a novel cytokine from human fibroblasts that specifically inhibits osteoclastogenesis .
Author Tsuda E, Goto M, Mochizuki S, Yano K, Kobayashi F, Morinaga T and Higashio K.
Journal Biochem. Biophys. Res. Commun. 234 (1), 137-142 (1997)
Title Osteoprotegerin: a novel secreted protein involved in the regulation of bone density .
Author Simonet WS, Lacey DL, Dunstan CR, Kelley M, Chang MS, Luthy R, Nguyen HQ, Wooden S, Bennett L, Boone T, Shimamoto G, DeRose M, Elliott R, Colombero A, Tan HL, Trail G, Sullivan J, Davy E, Bucay N, Renshaw-Gegg L, Hughes TM, Hill D, Pattison W, Campbell P, Sander S, Van G, Tarpley J, Derby P, Lee R and Boyle WJ.
Journal Cell 89 (2), 309-319 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.