Homo sapiens platelet-derived growth factor receptor, beta polypeptide (PDGFRB), mRNA.
| RefSeq Version | NM_002609.3, 68216043 |
| Length | 5718 bp |
| Structure | linear |
| Update Date | 01-MAY-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens platelet-derived growth factor receptor, beta polypeptide (PDGFRB), mRNA. |
| Product | beta-type platelet-derived growth factor receptor precursor |
| Comment | Summary: This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. This gene is flanked on chromosome 5 by the genes for granulocyte-macrophage colony-stimulating factor and macrophage-colony stimulating factor receptor; all three genes may be implicated in the 5-q syndrome. A translocation between chromosomes 5 and 12, that fuses this gene to that of the translocation, ETV6, leukemia gene, results in chronic myeloproliferative disorder with eosinophilia. [provided by RefSeq]. |
| RefSeq | NP_002600.1 |
| CDS | 470..3790 | Exon (1) | 1..463 | Exon (2) | 1..463 | Exon (3) | 464..509 | Exon (4) | 510..833 | Exon (5) | 834..1100 | Exon (6) | 1101..1228 | Exon (7) | 1229..1403 | Exon (8) | 1404..1596 | Exon (9) | 1597..1712 | Exon (10) | 1713..1836 | Exon (11) | 1837..2048 | Exon (12) | 2049..2143 | Exon (13) | 2144..2276 | Exon (14) | 2277..2381 | Exon (15) | 2382..2492 | Exon (16) | 2493..2652 | Exon (17) | 2653..2813 | Exon (18) | 2814..2932 | Exon (19) | 2933..3055 | Exon (20) | 3056..3167 | Exon (21) | 3168..3267 | Exon (22) | 3268..3373 | Exon (23) | 3374..3606 | Exon (24) | 3607..5714 |
| Translation | MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPV
VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV
EPEPELEQLPDSGCPAPRAEAEDSFL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(36) | - | t, c | dbSNP:7718187 |
| complement(103) | - | g, c | dbSNP:10071918 |
| complement(112) | - | g, a | dbSNP:3815373 |
| complement(168) | - | g, a | dbSNP:2302273 |
| complement(244) | - | , g | dbSNP:55877485 |
| complement(554) | - | t, a | dbSNP:17110944 |
| complement(571) | - | g, a | dbSNP:17708515 |
| complement(586) | - | , c | dbSNP:66522314 |
| complement(719) | - | t, c | dbSNP:80162387 |
| complement(893) | - | , t | dbSNP:67501972 |
| complement(923) | - | , t | dbSNP:67055471 |
| complement(1008) | - | g, a | dbSNP:17853027 |
| 1050 | + | c, t | dbSNP:2229560 |
| complement(1059) | - | t, c | dbSNP:116642123 |
| complement(1093) | - | t, c | dbSNP:78791948 |
| complement(1183) | - | g, a | dbSNP:41287114 |
| complement(1225) | - | , t | dbSNP:66776888 |
| complement(1313) | - | t, c | dbSNP:34586048 |
| complement(1349) | - | t, g | dbSNP:61732347 |
| complement(1414) | - | g, a | dbSNP:56069016 |
| complement(1415) | - | t, c | dbSNP:41287112 |
| complement(1441) | - | t, c | dbSNP:61746319 |
| 1502 | + | c, t | dbSNP:2229558 |
| complement(1504) | - | t, c | dbSNP:55889271 |
| complement(1558) | - | g, c | dbSNP:10075631 |
| 1618 | + | c, g | dbSNP:2228439 |
| complement(1800..1801) | - | , t | dbSNP:67735560 |
| complement(1860) | - | g, a | dbSNP:74943037 |
| complement(1862) | - | g, a | dbSNP:116171826 |
| complement(1922) | - | t, c | dbSNP:41287110 |
| complement(1968) | - | c, a | dbSNP:61747481 |
| complement(1986) | - | c, a | dbSNP:79387608 |
| complement(2230) | - | t, c | dbSNP:56078873 |
| complement(2323) | - | t, c | dbSNP:56072663 |
| complement(2370..2371) | - | t, c | dbSNP:2342254 |
| complement(2391) | - | t, c | dbSNP:56339845 |
| complement(2569..2570) | - | , g | dbSNP:66857682 |
| complement(2582) | - | g, a | dbSNP:112292721 |
| complement(2589) | - | , t | dbSNP:67668044 |
| complement(2611) | - | c, a | dbSNP:113395639 |
| complement(2621) | - | t, a | dbSNP:35322465 |
| complement(2737) | - | g, a | dbSNP:56112987 |
| complement(2932) | - | g, a | dbSNP:78336563 |
| complement(2935) | - | g, a | dbSNP:55830572 |
| complement(2948) | - | , g | dbSNP:67186817 |
| complement(2992) | - | t, c | dbSNP:41287108 |
| complement(3070) | - | t, c | dbSNP:246395 |
| complement(3099) | - | t, g | dbSNP:78642472 |
| complement(3239) | - | , c | dbSNP:66748971 |
| complement(3313) | - | t, c | dbSNP:55647240 |
| complement(3429) | - | t, c | dbSNP:35731372 |
| complement(3441) | - | t, c | dbSNP:75748462 |
| complement(3460..3461) | - | , a | dbSNP:67773744 |
| complement(3465..3466) | - | , a | dbSNP:66599735 |
| 3487 | + | c, t | dbSNP:2229559 |
| 3559 | + | c, t | dbSNP:2228440 |
| complement(3658..3659) | - | , g | dbSNP:67001123 |
| complement(3721) | - | t, c | dbSNP:246388 |
| complement(3756) | - | g, a | dbSNP:114435947 |
| complement(3824) | - | , g | dbSNP:67340977 |
| 3829 | + | a, c, g | dbSNP:2229561 |
| 3863 | + | a, g | dbSNP:2229562 |
| complement(4066) | - | t, c | dbSNP:246387 |
| complement(4132) | - | g, a | dbSNP:6887454 |
| complement(4324) | - | t, g | dbSNP:77556386 |
| complement(4515) | - | g, c | dbSNP:7726051 |
| complement(4595) | - | g, a | dbSNP:1017375 |
| complement(4796) | - | c, a | dbSNP:7447238 |
| complement(4863) | - | , c | dbSNP:55712339 |
| 5011 | + | a, c | dbSNP:1049960 |
| complement(5073) | - | g, a | dbSNP:115587493 |
| complement(5223) | - | , c | dbSNP:56271341 |
| complement(5256) | - | , a | dbSNP:56379567 |
| complement(5261) | - | , c | dbSNP:55769219 |
| 5363 | + | g, t | dbSNP:12238 |
| complement(5368) | - | g, c | dbSNP:57883901 |
| 5446 | + | g, t | dbSNP:1804142 |
| 5581 | + | a, g | dbSNP:6674 |
| complement(5643) | - | t, a | dbSNP:60581443 |
| complement(5644) | - | t, c | dbSNP:1864973 |
| Gene Symbol | PDGFRB |
| Gene Synonym | CD140B; JTK12; PDGFR; PDGFR1 |
| Chromosome | 5 |
| Locus Map | 5q33.1 |
| All Transcripts | NM_002609 |
| Title | Weak association of the platelet-derived growth factor beta (PDGFB) and PDGF receptor beta (PDGFRB) genes with schizophrenia and schizoaffective disorder . |
| Author | Zai,G., Zai,C., Tiwari,A., King,N., Braithwaite,J., van Tol,H. and Kennedy,J.L. |
| Journal | World J. Biol. Psychiatry 12 (2), 127-133 (2011) |
| Title | PDGFR signaling blockade in marrow stroma impairs lung cancer bone metastasis . |
| Author | Catena,R., Luis-Ravelo,D., Anton,I., Zandueta,C., Salazar-Colocho,P., Larzabal,L., Calvo,A. and Lecanda,F. |
| Journal | Cancer Res. 71 (1), 164-174 (2011) |
| Title | A novel signaling axis of matriptase/PDGF-D/ss-PDGFR in human prostate cancer . |
| Author | Ustach,C.V., Huang,W., Conley-LaComb,M.K., Lin,C.Y., Che,M., Abrams,J. and Kim,H.R. |
| Journal | Cancer Res. 70 (23), 9631-9640 (2010) |
| Title | Endothelial progenitor cells induce a phenotype shift in differentiated endothelial cells towards PDGF/PDGFRbeta axis-mediated angiogenesis . |
| Author | Wyler von Ballmoos,M., Yang,Z., Volzmann,J., Baumgartner,I., Kalka,C. and Di Santo,S. |
| Journal | PLoS ONE 5 (11), E14107 (2010) |
| Title | Clinicopathological significance of platelet-derived growth factor (PDGF)-B and vascular endothelial growth factor-A expression, PDGF receptor-beta phosphorylation, and microvessel density in gastric cancer . |
| Author | Suzuki,S., Dobashi,Y., Hatakeyama,Y., Tajiri,R., Fujimura,T., Heldin,C.H. and Ooi,A. |
| Journal | BMC Cancer 10, 659 (2010) |
| Title | Distinct phosphotyrosines on a growth factor receptor bind to specific molecules that mediate different signaling pathways . |
| Author | Fantl,W.J., Escobedo,J.A., Martin,G.A., Turck,C.W., del Rosario,M., McCormick,F. and Williams,L.T. |
| Journal | Cell 69 (3), 413-423 (1992) |
| Title | SH2 domains of the p85 alpha subunit of phosphatidylinositol 3-kinase regulate binding to growth factor receptors . |
| Author | McGlade,C.J., Ellis,C., Reedijk,M., Anderson,D., Mbamalu,G., Reith,A.D., Panayotou,G., End,P., Bernstein,A., Kazlauskas,A. et al. |
| Journal | Mol. Cell. Biol. 12 (3), 991-997 (1992) |
| Title | Two additional protein-tyrosine kinases expressed in human lung: fourth member of the fibroblast growth factor receptor family and an intracellular protein-tyrosine kinase . |
| Author | Holtrich,U., Brauninger,A., Strebhardt,K. and Rubsamen-Waigmann,H. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 88 (23), 10411-10415 (1991) |
| Title | Ligand-induced interaction between alpha- and beta-type platelet-derived growth factor (PDGF) receptors: role of receptor heterodimers in kinase activation . |
| Author | Kanakaraj,P., Raj,S., Khan,S.A. and Bishayee,S. |
| Journal | Biochemistry 30 (7), 1761-1767 (1991) |
| Title | Association between the PDGF receptor and members of the src family of tyrosine kinases . |
| Author | Kypta,R.M., Goldberg,Y., Ulug,E.T. and Courtneidge,S.A. |
| Journal | Cell 62 (3), 481-492 (1990) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |