• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens platelet-derived growth factor receptor, beta polypeptide (PDGFRB), mRNA.


RefSeq Accession Definition Services Price Order
NM_002609 Homo sapiens platelet-derived growth factor receptor, beta polypeptide (PDGFRB), mRNA. ORF Sequence $1162.35
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002609.3, 68216043
Length 5718 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens platelet-derived growth factor receptor, beta polypeptide (PDGFRB), mRNA.
Product platelet-derived growth factor receptor beta precursor
Comment

Summary: This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. This gene is flanked on chromosome 5 by the genes for granulocyte-macrophage colony-stimulating factor and macrophage-colony stimulating factor receptor; all three genes may be implicated in the 5-q syndrome. A translocation between chromosomes 5 and 12, that fuses this gene to that of the translocation, ETV6, leukemia gene, results in chronic myeloproliferative disorder with eosinophilia. [provided by RefSeq, Jul 2008].

RefSeq NP_002600.1
CDS 470..3790
Misc Feature(1)389..391
Misc Feature(2)1151..1405
Misc Feature(3)1409..1714
Misc Feature(4)1742..2038
Misc Feature(5)2048..2053
Misc Feature(6)2066..2128
Misc Feature(7)2141..2146
Misc Feature(8)2153..3328
Misc Feature(9)2153..2155
Misc Feature(10)2153..2155
Misc Feature(11)2204..2206
Misc Feature(12)2204..2206
Misc Feature(13)2204..2206
Misc Feature(14)2210..2212
Misc Feature(15)2210..2212
Misc Feature(16)2234..2236
Misc Feature(17)order(2285..2299,2309..2311,2363..2365,2369..2371,
Misc Feature(18)order(2285..2299,2309..2311,2363..2365,2369..2371,
Misc Feature(19)order(2297..2299,2531..2533,2537..2539,2945..2947,
Misc Feature(20)2615..2617
Misc Feature(21)2615..2617
Misc Feature(22)2687..2689
Misc Feature(23)2687..2689
Misc Feature(24)2687..2689
Misc Feature(25)2720..2722
Misc Feature(26)2720..2722
Misc Feature(27)2720..2722
Misc Feature(28)2720..2722
Misc Feature(29)2720..2722
Misc Feature(30)2756..2758
Misc Feature(31)2756..2758
Misc Feature(32)2780..2782
Misc Feature(33)2780..2782
Misc Feature(34)2780..2782
Misc Feature(35)2780..2782
Misc Feature(36)2792..2794
Misc Feature(37)2792..2794
Misc Feature(38)2801..2803
Misc Feature(39)<2840..3328
Misc Feature(40)order(2996..3016,3062..3073)
Misc Feature(41)3038..3040
Misc Feature(42)3038..3040
Misc Feature(43)3038..3040
Misc Feature(44)3494..3496
Misc Feature(45)3494..3496
Misc Feature(46)3494..3496
Misc Feature(47)3530..3532
Misc Feature(48)3530..3532
Misc Feature(49)3530..3532
Misc Feature(50)3530..3532
Exon (1)1..463
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (2)464..509
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (3)510..833
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (4)834..1100
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (5)1101..1228
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (6)1229..1403
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (7)1404..1596
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (8)1597..1712
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (9)1713..1836
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (10)1837..2048
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (11)2049..2143
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (12)2144..2276
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (13)2277..2381
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (14)2382..2492
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (15)2493..2652
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (16)2653..2813
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (17)2814..2932
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (18)2933..3055
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (19)3056..3167
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (20)3168..3267
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (21)3268..3373
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (22)3374..3606
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (23)3607..5714
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Translation MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPV VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFV PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFS GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV EPEPELEQLPDSGCPAPRAEAEDSFL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(36)-dbSNP:
complement(36)-t, cdbSNP:7718187
complement(103)-g, cdbSNP:10071918
complement(112)-g, adbSNP:3815373
complement(168)-g, adbSNP:2302273
complement(225)-t, cdbSNP:186540442
complement(244)-, gdbSNP:55877485
complement(473)-g, adbSNP:148272095
complement(480)-t, gdbSNP:144923639
complement(481)-t, cdbSNP:138641101
complement(486)-g, adbSNP:150173975
complement(487)-t, cdbSNP:201570042
complement(500)-g, cdbSNP:199730626
complement(511)-dbSNP:
complement(511)-g, adbSNP:145316660
complement(512)-t, cdbSNP:148853962
complement(520)-t, cdbSNP:145437694
complement(554)-t, adbSNP:17110944
complement(571)-g, adbSNP:17708515
complement(586)-, cdbSNP:66522314
complement(633)-g, adbSNP:147952898
complement(644)-g, adbSNP:144954868
complement(645)-g, adbSNP:202213873
complement(679..680)-, gdbSNP:141528614
complement(719)-t, cdbSNP:80162387
complement(721)-t, cdbSNP:140893382
complement(732)-g, adbSNP:147303614
complement(739)-g, adbSNP:188981582
complement(743)-c, adbSNP:141870925
complement(781)-g, adbSNP:148534675
complement(801)-t, cdbSNP:144757799
complement(811)-t, gdbSNP:149347871
complement(835)-dbSNP:
complement(835)-g, adbSNP:200535821
complement(888)-g, adbSNP:138830253
complement(893)-, tdbSNP:67501972
complement(917)-g, adbSNP:199522807
complement(923)-, tdbSNP:67055471
complement(955)-t, cdbSNP:147141808
complement(968)-t, cdbSNP:144857517
complement(998)-g, adbSNP:142683442
complement(1008)-g, adbSNP:17853027
complement(1050)-t, cdbSNP:2229560
complement(1055)-c, adbSNP:145459651
complement(1059)-t, cdbSNP:116642123
complement(1069)-g, adbSNP:148218530
complement(1183)-dbSNP:
complement(1183)-g, adbSNP:41287114
complement(1195)-g, cdbSNP:149027530
complement(1225)-, tdbSNP:66776888
complement(1235)-dbSNP:
complement(1235)-g, adbSNP:147568171
complement(1249)-t, cdbSNP:141245163
complement(1252)-t, cdbSNP:142649064
complement(1253)-t, adbSNP:202093144
complement(1313)-t, cdbSNP:34586048
complement(1338)-g, cdbSNP:147707126
complement(1349)-t, gdbSNP:61732347
complement(1414)-dbSNP:
complement(1414)-g, adbSNP:56069016
complement(1415)-t, cdbSNP:41287112
complement(1416)-g, adbSNP:201765870
complement(1441)-t, cdbSNP:61746319
complement(1469)-g, adbSNP:150846835
complement(1502)-t, cdbSNP:2229558
complement(1503)-g, adbSNP:201250234
complement(1504)-t, cdbSNP:55889271
complement(1532)-g, adbSNP:140008145
complement(1552)-g, adbSNP:146064275
complement(1558)-g, cdbSNP:10075631
complement(1577)-g, adbSNP:200684708
complement(1588)-t, cdbSNP:200225593
complement(1595)-g, adbSNP:142621427
complement(1612)-dbSNP:
complement(1612)-c, adbSNP:138127039
complement(1618)-g, cdbSNP:2228439
complement(1624)-g, adbSNP:149294219
complement(1692)-g, cdbSNP:200203294
complement(1748)-dbSNP:
complement(1748)-g, adbSNP:199873101
complement(1802..1803)-, tdbSNP:67735560
complement(1844)-dbSNP:
complement(1844)-g, cdbSNP:138606056
complement(1845)-t, cdbSNP:149274963
complement(1847)-t, cdbSNP:202179598
complement(1860)-g, adbSNP:74943037
complement(1862)-g, adbSNP:116171826
complement(1865)-g, adbSNP:139553770
complement(1907)-t, cdbSNP:146931547
complement(1922)-t, cdbSNP:41287110
complement(1942)-t, cdbSNP:147742846
complement(1968)-c, adbSNP:61747481
complement(1973)-g, adbSNP:142992960
complement(1974)-t, cdbSNP:148974733
complement(1986)-c, adbSNP:79387608
complement(1989)-t, cdbSNP:145823245
complement(2005)-g, adbSNP:186555112
complement(2008)-g, adbSNP:150562879
complement(2074)-dbSNP:
complement(2074)-t, gdbSNP:149788833
complement(2126)-t, adbSNP:201130170
complement(2163)-dbSNP:
complement(2163)-t, cdbSNP:140081345
complement(2230)-t, cdbSNP:56078873
complement(2287)-dbSNP:
complement(2287)-g, adbSNP:199649903
complement(2290)-g, adbSNP:144198387
complement(2322)-g, cdbSNP:139554380
complement(2323)-t, cdbSNP:56072663
complement(2341)-g, adbSNP:141371542
complement(2353)-t, cdbSNP:201518972
complement(2365)-g, adbSNP:200452401
complement(2370..2371)-t, cdbSNP:2342254
complement(2390)-dbSNP:
complement(2390)-g, adbSNP:201183721
complement(2391)-t, cdbSNP:56339845
complement(2407)-t, cdbSNP:200931982
complement(2427)-t, cdbSNP:148655406
complement(2440)-g, adbSNP:138486655
complement(2447)-t, gdbSNP:144050370
complement(2523)-dbSNP:
complement(2523)-t, cdbSNP:200986052
complement(2524)-t, gdbSNP:143475177
complement(2552)-g, adbSNP:138008832
complement(2564)-t, cdbSNP:200834112
complement(2569..2570)-, gdbSNP:66857682
complement(2582)-g, adbSNP:112292721
complement(2589)-, tdbSNP:67668044
complement(2592)-t, cdbSNP:200519248
complement(2611)-c, adbSNP:113395639
complement(2614)-g, adbSNP:144015066
complement(2621)-t, adbSNP:35322465
complement(2632)-g, adbSNP:146967726
complement(2633)-t, c, adbSNP:142689325
complement(2664)-dbSNP:
complement(2664)-c, adbSNP:141793092
complement(2668)-g, adbSNP:192355633
complement(2680)-g, adbSNP:138397842
complement(2681)-t, cdbSNP:150474738
complement(2713)-t, cdbSNP:148789757
complement(2737)-g, adbSNP:56112987
complement(2749)-g, adbSNP:200377656
complement(2787)-t, gdbSNP:200197608
complement(2800)-g, adbSNP:201260232
complement(2834)-dbSNP:
complement(2834)-c, adbSNP:190620156
complement(2884)-g, cdbSNP:140614277
complement(2932)-g, adbSNP:78336563
complement(2935)-dbSNP:
complement(2935)-g, adbSNP:55830572
complement(2948)-, gdbSNP:67186817
complement(2953)-t, cdbSNP:143342011
complement(2968)-t, gdbSNP:181973599
complement(2971)-g, adbSNP:143375423
complement(2987)-t, cdbSNP:200077894
complement(2992)-t, cdbSNP:41287108
complement(3034)-t, cdbSNP:201473517
complement(3055)-g, adbSNP:201662789
complement(3070)-dbSNP:
complement(3070)-t, cdbSNP:246395
complement(3085)-t, cdbSNP:148709288
complement(3099)-t, gdbSNP:78642472
complement(3100..3101)-, gdbSNP:146729366
complement(3124)-g, adbSNP:144234864
complement(3174)-dbSNP:
complement(3174)-g, adbSNP:200865355
complement(3225)-t, cdbSNP:145717708
complement(3233)-g, cdbSNP:143067190
complement(3239)-, cdbSNP:66748971
complement(3256)-g, adbSNP:139037786
complement(3295)-dbSNP:
complement(3295)-t, cdbSNP:200373342
complement(3313)-t, cdbSNP:55647240
complement(3358)-g, adbSNP:139623802
complement(3378)-dbSNP:
complement(3378)-t, cdbSNP:150600919
complement(3429)-t, cdbSNP:35731372
complement(3439)-g, adbSNP:139699861
complement(3440)-g, adbSNP:140261309
complement(3441)-t, cdbSNP:75748462
complement(3445)-t, cdbSNP:201769526
complement(3461..3462)-, adbSNP:67773744
complement(3466..3467)-, adbSNP:66599735
complement(3487)-t, cdbSNP:2229559
complement(3488)-t, cdbSNP:142762235
complement(3495)-t, cdbSNP:148183775
complement(3499)-c, adbSNP:182175304
complement(3515)-t, cdbSNP:201061735
complement(3529)-g, cdbSNP:189849168
complement(3559)-t, cdbSNP:2228440
complement(3588)-c, adbSNP:149417689
complement(3655)-dbSNP:
complement(3655)-g, adbSNP:138940200
complement(3658..3659)-, gdbSNP:67001123
complement(3673)-g, adbSNP:141511317
complement(3721)-t, cdbSNP:246388
complement(3739)-t, cdbSNP:183852315
complement(3744)-g, adbSNP:146614144
complement(3756)-g, adbSNP:114435947
complement(3757)-t, cdbSNP:140615815
complement(3762)-t, cdbSNP:151236133
complement(3826)-g, cdbSNP:181113578
complement(3828)-g, cdbSNP:202160957
complement(3829)-g, c, adbSNP:2229561
complement(3830)-, gdbSNP:67340977
complement(3863)-g, adbSNP:2229562
complement(4066)-t, cdbSNP:246387
complement(4132)-g, adbSNP:6887454
complement(4432)-g, adbSNP:138535908
complement(4480)-t, cdbSNP:189852053
complement(4515)-g, cdbSNP:7726051
complement(4595)-g, adbSNP:1017375
complement(4630)-c, adbSNP:144647473
complement(4688)-t, cdbSNP:185163183
complement(4751)-t, cdbSNP:193195949
complement(4796)-c, adbSNP:7447238
complement(4863)-, cdbSNP:55712339
complement(4934)-g, adbSNP:140779761
complement(4968)-g, adbSNP:150973752
complement(5011)-c, adbSNP:1049960
complement(5073)-g, adbSNP:188715938
complement(5210..5212)-, cttdbSNP:145327251
complement(5223)-, cdbSNP:56271341
complement(5256)-, adbSNP:56379567
complement(5261)-, cdbSNP:55769219
complement(5363)-t, gdbSNP:12238
complement(5368)-g, cdbSNP:57883901
complement(5411)-g, adbSNP:143547069
complement(5446)-t, gdbSNP:1804142
complement(5581)-g, adbSNP:6674
complement(5637)-c, adbSNP:148889362
complement(5643)-t, adbSNP:60581443
complement(5644)-t, cdbSNP:1864973
Gene SymbolPDGFRB
Gene SynonymCD140B; IBGC4; JTK12; PDGFR; PDGFR-1; PDGFR1
Chromosome5
Locus Map5q33.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002609 Homo sapiens platelet-derived growth factor receptor, beta polypeptide (PDGFRB), mRNA. Full Length $2573.10
ORF Sequence $1162.35
Title Mutation of the PDGFRB gene as a cause of idiopathic basal ganglia calcification .
Author Nicolas,G., Pottier,C., Maltete,D., Coutant,S., Rovelet-Lecrux,A., Legallic,S., Rousseau,S., Vaschalde,Y., Guyant-Marechal,L., Augustin,J., Martinaud,O., Defebvre,L., Krystkowiak,P., Pariente,J., Clanet,M., Labauge,P., Ayrignac,X., Lefaucheur,R., Le Ber,I., Frebourg,T., Hannequin,D. and Campion,D.
Journal Neurology 80 (2), 181-187 (2013)
Title PDGFR blockade is a rational and effective therapy for NPM-ALK-driven lymphomas .
Author Laimer,D., Dolznig,H., Kollmann,K., Vesely,P.W., Schlederer,M., Merkel,O., Schiefer,A.I., Hassler,M.R., Heider,S., Amenitsch,L., Thallinger,C., Staber,P.B., Simonitsch-Klupp,I., Artaker,M., Lagger,S., Turner,S.D., Pileri,S., Piccaluga,P.P., Valent,P., Messana,K., Landra,I., Weichhart,T., Knapp,S., Shehata,M., Todaro,M., Sexl,V., Hofler,G., Piva,R., Medico,E., Ruggeri,B.A., Cheng,M., Eferl,R., Egger,G., Penninger,J.M., Jaeger,U., Moriggl,R., Inghirami,G. and Kenner,L.
Journal Nat. Med. 18 (11), 1699-1704 (2012)
Title Differential tumorigenic potential and matriptase activation between PDGF B versus PDGF D in prostate cancer .
Author Najy,A.J., Won,J.J., Movilla,L.S. and Kim,H.R.
Journal Mol. Cancer Res. 10 (8), 1087-1097 (2012)
Title Hydrophobic matching controls the tilt and stability of the dimeric platelet-derived growth factor receptor (PDGFR) beta transmembrane segment .
Author Muhle-Goll,C., Hoffmann,S., Afonin,S., Grage,S.L., Polyansky,A.A., Windisch,D., Zeitler,M., Burck,J. and Ulrich,A.S.
Journal J. Biol. Chem. 287 (31), 26178-26186 (2012)
Title Platelet-derived growth factor receptors differentially inform intertumoral and intratumoral heterogeneity .
Author Kim,Y., Kim,E., Wu,Q., Guryanova,O., Hitomi,M., Lathia,J.D., Serwanski,D., Sloan,A.E., Weil,R.J., Lee,J., Nishiyama,A., Bao,S., Hjelmeland,A.B. and Rich,J.N.
Journal Genes Dev. 26 (11), 1247-1262 (2012)
Title Distinct phosphotyrosines on a growth factor receptor bind to specific molecules that mediate different signaling pathways .
Author Fantl,W.J., Escobedo,J.A., Martin,G.A., Turck,C.W., del Rosario,M., McCormick,F. and Williams,L.T.
Journal Cell 69 (3), 413-423 (1992)
Title Phosphorylation sites in the PDGF receptor with different specificities for binding GAP and PI3 kinase in vivo .
Author Kashishian,A., Kazlauskas,A. and Cooper,J.A.
Journal EMBO J. 11 (4), 1373-1382 (1992)
Title SH2 domains of the p85 alpha subunit of phosphatidylinositol 3-kinase regulate binding to growth factor receptors .
Author McGlade,C.J., Ellis,C., Reedijk,M., Anderson,D., Mbamalu,G., Reith,A.D., Panayotou,G., End,P., Bernstein,A., Kazlauskas,A. et al.
Journal Mol. Cell. Biol. 12 (3), 991-997 (1992)
Title Functions of the major tyrosine phosphorylation site of the PDGF receptor beta subunit .
Author Kazlauskas,A., Durden,D.L. and Cooper,J.A.
Journal Cell Regul. 2 (6), 413-425 (1991)
Title Association between the PDGF receptor and members of the src family of tyrosine kinases .
Author Kypta,R.M., Goldberg,Y., Ulug,E.T. and Courtneidge,S.A.
Journal Cell 62 (3), 481-492 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878