• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens platelet-derived growth factor receptor, beta polypeptide (PDGFRB), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002609 Homo sapiens platelet-derived growth factor receptor, beta polypeptide (PDGFRB), mRNA. GenEZ ORF Cloning In-stock $1198.00 $1149.00 16

*Business Day

Related Services

RefSeq Version NM_002609.3, 68216043
Length 5718 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens platelet-derived growth factor receptor, beta polypeptide (PDGFRB), mRNA.
Product platelet-derived growth factor receptor beta precursor
Comment

Summary: This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. This gene is flanked on chromosome 5 by the genes for granulocyte-macrophage colony-stimulating factor and macrophage-colony stimulating factor receptor; all three genes may be implicated in the 5-q syndrome. A translocation between chromosomes 5 and 12, that fuses this gene to that of the translocation, ETV6, leukemia gene, results in chronic myeloproliferative disorder with eosinophilia. [provided by RefSeq, Jul 2008].

RefSeq NP_002600.1
CDS 470..3790
Misc Feature(1)389..391
Misc Feature(2)587..799
Misc Feature(3)608..775
Misc Feature(4)1133..1399
Misc Feature(5)1151..1405
Misc Feature(6)1409..1714
Misc Feature(7)1742..2038
Misc Feature(8)2048..2053
Misc Feature(9)2066..2128
Misc Feature(10)2141..2146
Misc Feature(11)2153..3328
Misc Feature(12)2153..2155
Misc Feature(13)2153..2155
Misc Feature(14)2204..2206
Misc Feature(15)2204..2206
Misc Feature(16)2204..2206
Misc Feature(17)2210..2212
Misc Feature(18)2210..2212
Misc Feature(19)2234..2236
Misc Feature(20)2267..3328
Misc Feature(21)order(2285..2290,2294..2305,2309..2311,2363..2365,
Misc Feature(22)order(2285..2290,2294..2305,2309..2311,2363..2365,
Misc Feature(23)2615..2617
Misc Feature(24)2615..2617
Misc Feature(25)2687..2689
Misc Feature(26)2687..2689
Misc Feature(27)2687..2689
Misc Feature(28)2720..2722
Misc Feature(29)2720..2722
Misc Feature(30)2720..2722
Misc Feature(31)2720..2722
Misc Feature(32)2720..2722
Misc Feature(33)2756..2758
Misc Feature(34)2756..2758
Misc Feature(35)2780..2782
Misc Feature(36)2780..2782
Misc Feature(37)2780..2782
Misc Feature(38)2780..2782
Misc Feature(39)2792..2794
Misc Feature(40)2792..2794
Misc Feature(41)2801..2803
Misc Feature(42)order(2945..2947,2957..2959,3053..3067,3092..3094,
Misc Feature(43)2996..3073
Misc Feature(44)3038..3040
Misc Feature(45)3038..3040
Misc Feature(46)3038..3040
Misc Feature(47)3494..3496
Misc Feature(48)3494..3496
Misc Feature(49)3494..3496
Misc Feature(50)3530..3532
Misc Feature(51)3530..3532
Misc Feature(52)3530..3532
Misc Feature(53)3530..3532
Exon (1)1..463
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (2)464..509
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (3)510..833
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (4)834..1100
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (5)1101..1228
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (6)1229..1403
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (7)1404..1596
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (8)1597..1712
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (9)1713..1836
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (10)1837..2048
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (11)2049..2143
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (12)2144..2276
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (13)2277..2381
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (14)2382..2492
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (15)2493..2652
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (16)2653..2813
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (17)2814..2932
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (18)2933..3055
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (19)3056..3167
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (20)3168..3267
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (21)3268..3373
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (22)3374..3606
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Exon (23)3607..5714
Gene:PDGFRB
Gene Synonym:CD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Translation MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPV VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFV PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFS GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV EPEPELEQLPDSGCPAPRAEAEDSFL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(36)-dbSNP:
complement(36)-t, cdbSNP:7718187
complement(103)-g, cdbSNP:10071918
complement(103)-g, cdbSNP:386454570
complement(112)-g, adbSNP:3815373
complement(168)-g, adbSNP:2302273
complement(211)-t, cdbSNP:371860652
complement(225)-t, cdbSNP:186540442
complement(244)-, gdbSNP:55877485
complement(260)-t, cdbSNP:367550254
complement(473)-g, adbSNP:148272095
complement(474)-t, cdbSNP:372399976
complement(480)-t, gdbSNP:144923639
complement(481)-t, cdbSNP:138641101
complement(486)-g, adbSNP:150173975
complement(487)-t, cdbSNP:201570042
complement(500)-g, cdbSNP:199730626
complement(511)-dbSNP:
complement(511)-g, adbSNP:145316660
complement(512)-t, cdbSNP:148853962
complement(520)-t, cdbSNP:145437694
complement(554)-t, adbSNP:17110944
complement(564)-t, cdbSNP:368010583
complement(571)-g, adbSNP:17708515
complement(633)-g, adbSNP:147952898
complement(644)-g, adbSNP:144954868
complement(645)-g, adbSNP:202213873
complement(659)-g, adbSNP:367993439
complement(679..680)-, gdbSNP:141528614
complement(709)-t, gdbSNP:371465014
complement(719)-t, cdbSNP:80162387
complement(721)-t, cdbSNP:140893382
complement(726)-g, adbSNP:373647341
complement(732)-g, adbSNP:147303614
complement(739)-g, adbSNP:188981582
complement(743)-c, adbSNP:141870925
complement(765)-c, adbSNP:368624710
complement(781)-g, adbSNP:148534675
complement(801)-t, cdbSNP:144757799
complement(802)-g, adbSNP:374401315
complement(835)-dbSNP:
complement(835)-g, adbSNP:200535821
complement(846)-t, cdbSNP:371293050
complement(888)-g, adbSNP:138830253
complement(917)-g, adbSNP:199522807
complement(955)-t, cdbSNP:147141808
complement(968)-t, cdbSNP:144857517
complement(974)-g, adbSNP:368667212
complement(998)-g, adbSNP:142683442
complement(1008)-g, adbSNP:17853027
complement(1050)-t, cdbSNP:386561738
1050+c, tdbSNP:2229560
complement(1055)-c, adbSNP:145459651
complement(1059)-t, cdbSNP:116642123
complement(1069)-g, adbSNP:148218530
complement(1093)-t, gdbSNP:374440746
complement(1115)-dbSNP:
complement(1115)-t, cdbSNP:370817438
complement(1119)-g, cdbSNP:368231732
complement(1152)-g, cdbSNP:374239531
complement(1183)-g, adbSNP:41287114
complement(1195)-g, cdbSNP:149027530
complement(1235)-dbSNP:
complement(1235)-g, adbSNP:147568171
complement(1249)-t, cdbSNP:141245163
complement(1252)-t, cdbSNP:142649064
complement(1253)-t, adbSNP:202093144
complement(1286)-g, adbSNP:373131428
complement(1301)-t, gdbSNP:369581401
complement(1313)-t, cdbSNP:34586048
complement(1338)-g, cdbSNP:147707126
complement(1349)-t, gdbSNP:61732347
complement(1350)-g, adbSNP:374864774
complement(1414)-dbSNP:
complement(1414)-g, adbSNP:56069016
complement(1415)-t, cdbSNP:41287112
complement(1416)-g, adbSNP:201765870
complement(1437)-t, cdbSNP:374208706
complement(1440)-g, adbSNP:372924064
complement(1441)-t, cdbSNP:61746319
complement(1452)-g, adbSNP:369442822
complement(1469)-g, adbSNP:150846835
complement(1470)-t, cdbSNP:375079353
complement(1472)-t, cdbSNP:371519105
complement(1474)-t, cdbSNP:371830924
complement(1502)-t, cdbSNP:386561736
1502+c, tdbSNP:2229558
complement(1503)-g, adbSNP:201250234
complement(1504)-t, cdbSNP:55889271
complement(1514)-g, cdbSNP:368862822
complement(1532)-g, adbSNP:140008145
complement(1544)-t, cdbSNP:375484098
complement(1552)-g, adbSNP:146064275
complement(1558)-g, c, adbSNP:10075631
complement(1565)-t, cdbSNP:368602685
complement(1575)-g, adbSNP:375343084
complement(1577)-g, adbSNP:200684708
complement(1583)-t, cdbSNP:371975483
complement(1588)-t, cdbSNP:200225593
complement(1595)-g, adbSNP:142621427
complement(1612)-dbSNP:
complement(1612)-c, adbSNP:138127039
1618+c, gdbSNP:2228439
complement(1623)-t, cdbSNP:375122221
complement(1624)-g, adbSNP:149294219
complement(1645)-g, adbSNP:370380734
complement(1658)-g, adbSNP:377445092
complement(1686)-t, cdbSNP:374802057
complement(1692)-g, cdbSNP:200203294
complement(1722)-dbSNP:
complement(1722)-t, cdbSNP:371365227
complement(1748)-g, adbSNP:199873101
complement(1845)-dbSNP:
complement(1845)-t, cdbSNP:149274963
complement(1847)-t, cdbSNP:202179598
complement(1854)-g, adbSNP:372793684
complement(1860)-g, adbSNP:74943037
complement(1862)-g, adbSNP:116171826
complement(1862)-g, adbSNP:386455424
complement(1865)-g, adbSNP:139553770
complement(1876)-t, adbSNP:375139942
complement(1884)-t, adbSNP:371842708
complement(1906)-g, adbSNP:371550567
complement(1907)-t, cdbSNP:146931547
complement(1922)-t, cdbSNP:41287110
complement(1942)-t, cdbSNP:147742846
complement(1968)-c, adbSNP:61747481
complement(1973)-g, adbSNP:142992960
complement(1974)-t, cdbSNP:148974733
complement(1983)-g, adbSNP:367611195
1986+a, cdbSNP:79387608
complement(1989)-t, cdbSNP:145823245
complement(2005)-g, adbSNP:186555112
complement(2008)-g, adbSNP:150562879
complement(2023)-t, cdbSNP:371192118
complement(2035)-g, adbSNP:368599063
complement(2036)-t, cdbSNP:374412074
complement(2074)-dbSNP:
complement(2074)-t, gdbSNP:149788833
complement(2105)-t, cdbSNP:373049018
complement(2126)-t, adbSNP:201130170
2150+dbSNP:
2150+c, tdbSNP:367543286
complement(2163)-t, cdbSNP:140081345
complement(2194)-g, adbSNP:374172033
complement(2207)-t, cdbSNP:376202121
complement(2230)-t, cdbSNP:56078873
complement(2245)-g, cdbSNP:367951719
complement(2287)-dbSNP:
complement(2287)-g, adbSNP:199649903
complement(2322)-g, cdbSNP:139554380
complement(2323)-t, cdbSNP:56072663
complement(2341)-g, adbSNP:141371542
complement(2353)-t, cdbSNP:201518972
complement(2365)-g, adbSNP:200452401
complement(2371)-t, cdbSNP:2342254
complement(2390)-dbSNP:
complement(2390)-g, adbSNP:201183721
complement(2391)-t, cdbSNP:56339845
complement(2407)-t, cdbSNP:200931982
complement(2419)-t, cdbSNP:370147161
complement(2425)-t, cdbSNP:377739568
complement(2427)-t, cdbSNP:148655406
complement(2440)-g, adbSNP:138486655
2442+c, tdbSNP:397509381
complement(2447)-t, gdbSNP:144050370
complement(2523)-dbSNP:
complement(2523)-t, cdbSNP:200986052
complement(2552)-t, gdbSNP:138008832
complement(2553)-t, cdbSNP:375978065
complement(2564)-t, cdbSNP:200834112
complement(2582)-g, adbSNP:112292721
complement(2592)-t, cdbSNP:200519248
complement(2606)-t, cdbSNP:371341863
complement(2607)-g, adbSNP:368867827
complement(2611)-c, adbSNP:113395639
complement(2614)-g, adbSNP:144015066
complement(2621)-t, adbSNP:35322465
complement(2632)-g, adbSNP:146967726
complement(2633)-c, adbSNP:142689325
complement(2664)-dbSNP:
complement(2664)-c, adbSNP:141793092
complement(2668)-g, adbSNP:192355633
complement(2680)-g, adbSNP:138397842
complement(2681)-t, cdbSNP:150474738
complement(2713)-t, cdbSNP:148789757
complement(2737)-g, adbSNP:56112987
complement(2749)-g, adbSNP:200377656
complement(2767)-g, adbSNP:368817770
complement(2787)-t, gdbSNP:200197608
complement(2800)-g, adbSNP:201260232
complement(2834)-dbSNP:
complement(2834)-c, adbSNP:190620156
complement(2884)-g, cdbSNP:140614277
complement(2902)-g, adbSNP:370373380
complement(2932)-t, cdbSNP:386454721
complement(2932)-g, adbSNP:78336563
complement(2935)-dbSNP:
complement(2935)-g, adbSNP:55830572
complement(2936)-t, cdbSNP:377442091
complement(2953)-t, cdbSNP:143342011
complement(2968)-t, gdbSNP:181973599
complement(2971)-g, adbSNP:143375423
complement(2987)-t, cdbSNP:200077894
complement(2989)-g, adbSNP:371399585
complement(2992)-t, cdbSNP:41287108
complement(3034)-t, cdbSNP:201473517
complement(3055)-g, adbSNP:201662789
complement(3070)-dbSNP:
complement(3070)-t, cdbSNP:246395
complement(3085)-t, cdbSNP:148709288
3099+g, tdbSNP:78642472
complement(3100..3101)-, gdbSNP:146729366
complement(3112)-g, cdbSNP:369191106
complement(3124)-g, adbSNP:144234864
complement(3174)-dbSNP:
complement(3174)-g, adbSNP:200865355
complement(3185)-g, cdbSNP:372042979
complement(3225)-t, cdbSNP:145717708
complement(3233)-g, cdbSNP:143067190
complement(3256)-g, adbSNP:139037786
complement(3295)-dbSNP:
complement(3295)-t, cdbSNP:200373342
complement(3313)-t, cdbSNP:55647240
complement(3324)-g, cdbSNP:376007701
complement(3358)-g, adbSNP:139623802
complement(3378)-dbSNP:
complement(3378)-t, cdbSNP:150600919
complement(3388)-t, cdbSNP:370594710
3428+c, tdbSNP:397509382
complement(3429)-t, cdbSNP:35731372
complement(3439)-g, adbSNP:139699861
complement(3440)-g, adbSNP:140261309
complement(3441)-t, cdbSNP:75748462
complement(3445)-t, cdbSNP:201769526
3487+c, tdbSNP:2229559
complement(3488)-t, cdbSNP:142762235
complement(3495)-t, cdbSNP:148183775
complement(3499)-c, adbSNP:182175304
complement(3502)-g, adbSNP:375836509
complement(3515)-t, cdbSNP:201061735
complement(3524)-t, cdbSNP:372555492
complement(3529)-g, cdbSNP:189849168
complement(3540)-g, adbSNP:375922340
3559+c, tdbSNP:2228440
complement(3588)-c, adbSNP:149417689
complement(3593)-g, adbSNP:374003999
complement(3602)-t, cdbSNP:369848216
complement(3634)-dbSNP:
complement(3634)-g, adbSNP:375352303
complement(3673)-g, adbSNP:141511317
complement(3695)-g, adbSNP:376730887
complement(3721)-t, cdbSNP:246388
complement(3739)-t, cdbSNP:183852315
complement(3744)-g, adbSNP:146614144
complement(3751)-t, gdbSNP:367604639
complement(3756)-g, adbSNP:114435947
complement(3757)-t, cdbSNP:140615815
complement(3761)-g, adbSNP:267600485
complement(3762)-t, cdbSNP:151236133
complement(3765)-g, adbSNP:373655593
complement(3766)-t, cdbSNP:376978985
complement(3787)-g, cdbSNP:373320490
complement(3811)-g, adbSNP:369593849
complement(3818)-g, cdbSNP:376167357
complement(3826)-g, cdbSNP:181113578
complement(3828)-g, cdbSNP:202160957
3829+a, c, gdbSNP:2229561
3863+a, gdbSNP:2229562
complement(3865)-g, adbSNP:375798391
complement(4066)-t, cdbSNP:246387
complement(4132)-g, adbSNP:6887454
complement(4432)-g, adbSNP:138535908
complement(4474)-t, cdbSNP:372138290
complement(4480)-t, cdbSNP:189852053
complement(4515)-g, cdbSNP:7726051
complement(4595)-g, adbSNP:1017375
complement(4630)-c, adbSNP:144647473
complement(4688)-t, cdbSNP:185163183
complement(4751)-t, cdbSNP:193195949
complement(4796)-c, adbSNP:7447238
complement(4863)-, cdbSNP:55712339
complement(4934)-g, adbSNP:140779761
4968+a, gdbSNP:150973752
5011+a, cdbSNP:1049960
complement(5073)-g, adbSNP:188715938
complement(5150)-g, adbSNP:376421727
complement(5210..5212)-, cttdbSNP:145327251
complement(5223)-, cdbSNP:56271341
complement(5256)-, adbSNP:56379567
complement(5261)-, cdbSNP:55769219
5363+g, tdbSNP:12238
complement(5368)-g, cdbSNP:57883901
complement(5411)-g, adbSNP:143547069
5446+g, tdbSNP:1804142
complement(5549)-g, adbSNP:373517726
complement(5581)-g, adbSNP:6674
complement(5637)-c, adbSNP:148889362
complement(5643)-t, adbSNP:60581443
complement(5644)-t, cdbSNP:1864973
complement(5708..5709)-, gtdbSNP:374457215
Gene SymbolPDGFRB
Gene SynonymCD140B; IBGC4; IMF1; JTK12; PDGFR; PDGFR-1; PDGFR1
Chromosome5
Locus Map5q33.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002609 Homo sapiens platelet-derived growth factor receptor, beta polypeptide (PDGFRB), mRNA. In-stock $1198.00 $1149.00 16
XM_005268464 PREDICTED: Homo sapiens platelet-derived growth factor receptor, beta polypeptide (PDGFRB), transcript variant X1, mRNA. On-demand $1699.00 25
Title Phenotypic spectrum of probable and genetically-confirmed idiopathic basal ganglia calcification .
Author Nicolas G, Pottier C, Charbonnier C, Guyant-Marechal L, Le Ber I, Pariente J, Labauge P, Ayrignac X, Defebvre L, Maltete D, Martinaud O, Lefaucheur R, Guillin O, Wallon D, Chaumette B, Rondepierre P, Derache N, Fromager G, Schaeffer S, Krystkowiak P, Verny C, Jurici S, Sauvee M, Verin M, Lebouvier T, Rouaud O, Thauvin-Robinet C, Rousseau S, Rovelet-Lecrux A, Frebourg T, Campion D and Hannequin D.
Journal Brain 136 (PT 11), 3395-3407 (2013)
Title Breast cancer-derived K172N, D301V mutations abolish Na+/H+ exchanger regulatory factor 1 inhibition of platelet-derived growth factor receptor signaling .
Author Cheng S, Li Y, Yang Y, Feng D, Yang L, Ma Q, Zheng S, Meng R, Wang S, Wang S, Jiang WG and He J.
Journal FEBS Lett. 587 (20), 3289-3295 (2013)
Title Functional cross talk between CXCR4 and PDGFR on glioblastoma cells is essential for migration .
Author Sciaccaluga M, D'Alessandro G, Pagani F, Ferrara G, Lopez N, Warr T, Gorello P, Porzia A, Mainiero F, Santoro A, Esposito V, Cantore G, Castigli E and Limatola C.
Journal PLoS ONE 8 (9), E73426 (2013)
Title Cucurmosin induces the apoptosis of human pancreatic cancer CFPAC-1 cells by inactivating the PDGFR-beta signalling pathway .
Author Xie J, Wang C, Zhang B, Yang A, Yin Q, Huang H and Chen M.
Journal Pharmacol Rep 65 (3), 682-688 (2013)
Title Primary Familial Brain Calcification .
Author Sobrido,M.J., Coppola,G., Oliveira,J., Hopfer,S. and Geschwind,D.H.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dystonia Overview .
Author Klein,C., Marras,C. and Munchau,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Distinct phosphotyrosines on a growth factor receptor bind to specific molecules that mediate different signaling pathways .
Author Fantl WJ, Escobedo JA, Martin GA, Turck CW, del Rosario M, McCormick F and Williams LT.
Journal Cell 69 (3), 413-423 (1992)
Title Phosphorylation sites in the PDGF receptor with different specificities for binding GAP and PI3 kinase in vivo .
Author Kashishian A, Kazlauskas A and Cooper JA.
Journal EMBO J. 11 (4), 1373-1382 (1992)
Title SH2 domains of the p85 alpha subunit of phosphatidylinositol 3-kinase regulate binding to growth factor receptors .
Author McGlade CJ, Ellis C, Reedijk M, Anderson D, Mbamalu G, Reith AD, Panayotou G, End P, Bernstein A and Kazlauskas A.
Journal Mol. Cell. Biol. 12 (3), 991-997 (1992)
Title Functions of the major tyrosine phosphorylation site of the PDGF receptor beta subunit .
Author Kazlauskas A, Durden DL and Cooper JA.
Journal Cell Regul. 2 (6), 413-425 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.