• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens 3-phosphoinositide dependent protein kinase 1 (PDPK1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu13008 Homo sapiens 3-phosphoinositide dependent protein kinase 1 (PDPK1), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu13008C Homo sapiens 3-phosphoinositide dependent protein kinase 1 (PDPK1), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002613.4, 387849236
Length 1671 bp
Structure linear
Update Date 22-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens 3-phosphoinositide dependent protein kinase 1 (PDPK1), transcript variant 1, mRNA.
Product 3-phosphoinositide-dependent protein kinase 1 isoform 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC093525.3, BC012103.1 and AC141586.2. On May 17, 2012 this sequence version replaced gi:60498971.


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002604.1
CDS 150..1820
Misc Feature(1)174..176
Misc Feature(2)174..176
Misc Feature(3)174..176
Misc Feature(4)222..224
Misc Feature(5)222..224
Misc Feature(6)246..248
Misc Feature(7)387..1175
Misc Feature(8)393..1175
Misc Feature(9)order(411..425,435..437,474..476,480..482,576..578,
Misc Feature(10)order(411..422,429..431,435..437,474..476,480..482,
Misc Feature(11)order(423..425,645..647,651..653,762..764,768..770,
Misc Feature(12)order(813..845,864..890)
Misc Feature(13)870..872
Misc Feature(14)870..872
Misc Feature(15)870..872
Misc Feature(16)870..872
Misc Feature(17)882..884
Misc Feature(18)1209..1211
Misc Feature(19)1266..1268
Misc Feature(20)1266..1268
Misc Feature(21)1275..1277
Misc Feature(22)1326..1328
Misc Feature(23)1326..1328
Misc Feature(24)1329..1331
Misc Feature(25)1335..1337
Misc Feature(26)1335..1337
Misc Feature(27)1341..1343
Misc Feature(28)1377..1379
Misc Feature(29)1377..1379
Misc Feature(30)1470..1790
Misc Feature(31)order(1542..1544,1548..1550,1563..1565,1569..1571,
Misc Feature(32)1602..1604
Misc Feature(33)1686..1688
Misc Feature(34)1686..1688
Exon (1)1..173
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (2)174..434
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (3)435..477
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (4)478..615
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (5)616..760
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (6)761..858
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (7)859..934
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (8)935..1003
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (9)1004..1100
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (10)1101..1274
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (11)1275..1492
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (12)1493..1550
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (13)1551..1703
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (14)1704..7243
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Translation MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ EVWRQRYQSHPDAAVQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
30+dbSNP:
30+a, tdbSNP:191389305
200+dbSNP:
200+c, tdbSNP:61747742
200+c, tdbSNP:200979773
271+c, tdbSNP:55824600
380+a, gdbSNP:372064092
410+c, tdbSNP:758319
410+c, tdbSNP:369990948
431+a, cdbSNP:146388630
677+dbSNP:
677+a, gdbSNP:2041206
894+dbSNP:
894+a, gdbSNP:370069297
903+a, gdbSNP:373278831
905+a, gdbSNP:139543796
913+c, tdbSNP:144186731
923+c, tdbSNP:200735205
1309+dbSNP:
1309+a, gdbSNP:370279457
1319+c, gdbSNP:377095764
1327+c, gdbSNP:200076126
1342+c, tdbSNP:370494924
1353+a, gdbSNP:76887737
1354+c, tdbSNP:75824263
1355+a, gdbSNP:75077217
1357+a, gdbSNP:139732994
1359+c, tdbSNP:201780963
1381+a, gdbSNP:149931764
1434+c, gdbSNP:145034828
1448+c, tdbSNP:145594574
1456+a, gdbSNP:374111988
1467+g, tdbSNP:142153837
1509+dbSNP:
1509+a, gdbSNP:374649760
1736+c, tdbSNP:147843249
1742+c, tdbSNP:141143951
1758+a, cdbSNP:143425561
1786+a, gdbSNP:148008907
1805+c, tdbSNP:201375554
1808+c, tdbSNP:201646295
1809+a, gdbSNP:201983709
1821+c, tdbSNP:141708903
1831+a, gdbSNP:371050359
1835+a, gdbSNP:375625632
1871+c, tdbSNP:368140738
1872+a, gdbSNP:111905533
1873+g, tdbSNP:374100568
1928+c, tdbSNP:10866
complement(1965)-t, cdbSNP:3087784
2005+a, gdbSNP:375635017
2096+c, gdbSNP:148121766
complement(2116)-t, cdbSNP:140982354
2122+c, tdbSNP:13335284
2123+a, gdbSNP:369818229
2126+c, tdbSNP:374470586
2158+g, tdbSNP:371038846
2229+g, tdbSNP:189787811
2315+g, tdbSNP:181078294
2320..2321+, cgggggccgcagctttgtggdbSNP:374612917
2325+a, gdbSNP:113332295
2360+a, cdbSNP:375417064
2447+c, tdbSNP:185952911
complement(2552)-g, cdbSNP:79745244
complement(2608)-t, cdbSNP:138049982
2703+g, tdbSNP:71386677
2707+c, gdbSNP:142512073
2820+c, tdbSNP:190327635
2865+c, tdbSNP:78560075
2886+a, gdbSNP:138756291
2970+c, tdbSNP:76291069
2985+a, gdbSNP:74003037
3028+c, tdbSNP:144433575
3072+a, gdbSNP:376035884
3092+c, tdbSNP:148393103
3093+a, gdbSNP:141692563
complement(3108)-t, gdbSNP:147153606
3119+c, tdbSNP:183283033
3206+c, tdbSNP:28679688
3295..3297+, tgcdbSNP:149315179
3461+a, gdbSNP:370396602
3473+c, tdbSNP:367998725
3526+c, gdbSNP:373772013
3529+c, gdbSNP:372067195
3627+a, gdbSNP:4786296
3720+g, tdbSNP:4786297
complement(3774)-g, adbSNP:147975625
3796..3810+, gtcctgtgtctccatdbSNP:370970044
3844+a, gdbSNP:187363186
3856+c, gdbSNP:28457160
3888+g, tdbSNP:113716221
3919+c, tdbSNP:190975527
4009+a, gdbSNP:113054936
4040+a, gdbSNP:28615548
4068+a, gdbSNP:372950862
4130+c, tdbSNP:149131034
4198+c, gdbSNP:71386681
4311..4312+, adbSNP:199508475
4418+c, tdbSNP:147659496
5092..5093+, aadbSNP:58747637
5137+a, gdbSNP:182763560
5160+c, tdbSNP:61080418
5247+a, gdbSNP:187478880
5268+c, gdbSNP:112319026
5271+a, cdbSNP:191845035
5276+a, gdbSNP:144753105
5329+a, gdbSNP:182493826
5425+c, tdbSNP:11554593
5489+c, tdbSNP:112703875
5567+a, cdbSNP:373860725
5661+a, cdbSNP:367757589
5670+a, gdbSNP:371321013
5682+g, tdbSNP:368594243
5755..5760+, gtggggdbSNP:33994421
5866+c, gdbSNP:56318884
5867+, cdbSNP:376887169
5906+a, gdbSNP:2335110
5986+a, gdbSNP:187543589
6011+c, tdbSNP:2335111
6013+c, tdbSNP:137906061
complement(6127)-g, cdbSNP:3095103
6151+a, gdbSNP:369381082
6206+a, gdbSNP:376666016
6225+c, tdbSNP:185737005
6235+a, cdbSNP:190542981
6273..6274+, adbSNP:200815032
6303+a, gdbSNP:200359888
6357+c, gdbSNP:368831914
6491+c, tdbSNP:371727709
complement(6492)-t, cdbSNP:929457
6528+a, gdbSNP:201156361
6593+a, gdbSNP:184540154
6594+c, tdbSNP:189062814
6652..6655+, gtaadbSNP:5815128
6655..6658+, agtadbSNP:3030674
6729+a, gdbSNP:375159135
6943..6944+, tgdbSNP:201869822
7072+a, gdbSNP:386519181
complement(7072)-g, adbSNP:11554591
7141..7142+, ttdbSNP:111618468
7143+a, gdbSNP:386519182
complement(7143)-g, adbSNP:11554592
7148+c, g, tdbSNP:181213412
7152..7153+, tcdbSNP:201698119
7172+a, gdbSNP:185318792
7196+a, tdbSNP:189105574
Gene SymbolPDPK1
Gene SynonymPDK1; PDPK2; PRO0461
Chromosome16
Locus Map16p13.3
Title Upregulation of PKCeta by PKCepsilon and PDK1 involves two distinct mechanisms and promotes breast cancer cell survival .
Author Pal D, Outram SP and Basu A.
Journal Biochim. Biophys. Acta 1830 (8), 4040-4045 (2013)
Title Transition from heterotypic to homotypic PDK1 homodimerization is essential for TCR-mediated NF-kappaB activation .
Author Kang JA, Jeong SP, Park D, Hayden MS, Ghosh S and Park SG.
Journal J. Immunol. 190 (9), 4508-4515 (2013)
Title Selective requirement of PI3K/PDK1 signaling for Kras oncogene-driven pancreatic cell plasticity and cancer .
Author Eser S, Reiff N, Messer M, Seidler B, Gottschalk K, Dobler M, Hieber M, Arbeiter A, Klein S, Kong B, Michalski CW, Schlitter AM, Esposito I, Kind AJ, Rad L, Schnieke AE, Baccarini M, Alessi DR, Rad R, Schmid RM, Schneider G and Saur D.
Journal Cancer Cell 23 (3), 406-420 (2013)
Title Proliferative and antiapoptotic signaling stimulated by nuclear-localized PDK1 results in oncogenesis .
Author Kikani CK, Verona EV, Ryu J, Shen Y, Ye Q, Zheng L, Qian Z, Sakaue H, Nakamura K, Du J, Ji Q, Ogawa W, Sun LZ, Dong LQ and Liu F.
Journal Sci Signal 5 (249), RA80 (2012)
Title Silencing of PDK1 gene expression by RNA interference suppresses growth of esophageal cancer .
Author Yu J, Chen KS, Li YN, Yang J and Zhao L.
Journal Asian Pac. J. Cancer Prev. 13 (8), 4147-4151 (2012)
Title Mitogenic activation, phosphorylation, and nuclear translocation of protein kinase Bbeta .
Author Meier R, Alessi DR, Cron P, Andjelkovic M and Hemmings BA.
Journal J. Biol. Chem. 272 (48), 30491-30497 (1997)
Title Further evidence that the inhibition of glycogen synthase kinase-3beta by IGF-1 is mediated by PDK1/PKB-induced phosphorylation of Ser-9 and not by dephosphorylation of Tyr-216 .
Author Shaw M, Cohen P and Alessi DR.
Journal FEBS Lett. 416 (3), 307-311 (1997)
Title 3-Phosphoinositide-dependent protein kinase-1 (PDK1): structural and functional homology with the Drosophila DSTPK61 kinase .
Author Alessi DR, Deak M, Casamayor A, Caudwell FB, Morrice N, Norman DG, Gaffney P, Reese CB, MacDougall CN, Harbison D, Ashworth A and Bownes M.
Journal Curr. Biol. 7 (10), 776-789 (1997)
Title Dual requirement for a newly identified phosphorylation site in p70s6k .
Author Moser BA, Dennis PB, Pullen N, Pearson RB, Williamson NA, Wettenhall RE, Kozma SC and Thomas G.
Journal Mol. Cell. Biol. 17 (9), 5648-5655 (1997)
Title Characterization of a 3-phosphoinositide-dependent protein kinase which phosphorylates and activates protein kinase Balpha .
Author Alessi DR, James SR, Downes CP, Holmes AB, Gaffney PR, Reese CB and Cohen P.
Journal Curr. Biol. 7 (4), 261-269 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.