• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_002613 Homo sapiens 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, mRNA. ORF Sequence $484.59
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002613.4, 387849236
Length 7243 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, mRNA.
Product 3-phosphoinositide-dependent protein kinase 1 isoform 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC093525.3, BC012103.1 and AC141586.2. On May 17, 2012 this sequence version replaced gi:60498971.


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002604.1
CDS 150..1820
Misc Feature(1)174..176
Misc Feature(2)174..176
Misc Feature(3)174..176
Misc Feature(4)222..224
Misc Feature(5)222..224
Misc Feature(6)246..248
Misc Feature(7)387..1175
Misc Feature(8)393..1175
Misc Feature(9)order(411..425,435..437,474..476,480..482,576..578,
Misc Feature(10)order(411..422,429..431,435..437,474..476,480..482,
Misc Feature(11)order(423..425,645..647,651..653,762..764,768..770,
Misc Feature(12)order(813..845,864..890)
Misc Feature(13)870..872
Misc Feature(14)870..872
Misc Feature(15)870..872
Misc Feature(16)870..872
Misc Feature(17)882..884
Misc Feature(18)1209..1211
Misc Feature(19)1266..1268
Misc Feature(20)1266..1268
Misc Feature(21)1275..1277
Misc Feature(22)1326..1328
Misc Feature(23)1326..1328
Misc Feature(24)1329..1331
Misc Feature(25)1335..1337
Misc Feature(26)1335..1337
Misc Feature(27)1341..1343
Misc Feature(28)1377..1379
Misc Feature(29)1377..1379
Misc Feature(30)1518..1781
Misc Feature(31)order(1524..1547,1563..1586,1593..1613,1635..1652,
Misc Feature(32)order(1524..1526,1530..1532,1563..1565,1569..1571,
Misc Feature(33)1602..1604
Misc Feature(34)1686..1688
Misc Feature(35)1686..1688
Exon (1)1..173
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (2)174..434
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (3)435..477
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (4)478..615
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (5)616..760
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (6)761..858
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (7)859..934
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (8)935..1003
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (9)1004..1100
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (10)1101..1274
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (11)1275..1492
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (12)1493..1550
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (13)1551..1703
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Exon (14)1704..7243
Gene:PDPK1
Gene Synonym:PDK1; PDPK2; PRO0461
Translation MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ EVWRQRYQSHPDAAVQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
30+dbSNP:
30+a, tdbSNP:191389305
200+dbSNP:
200+c, tdbSNP:200979773
431+a, cdbSNP:146388630
905+dbSNP:
905+a, gdbSNP:139543796
913+c, tdbSNP:144186731
923+c, tdbSNP:200735205
1327+dbSNP:
1327+c, gdbSNP:200076126
1353+a, gdbSNP:76887737
1354+c, tdbSNP:75824263
1355+a, gdbSNP:75077217
1357+a, gdbSNP:139732994
1359+c, tdbSNP:201780963
1381+a, gdbSNP:149931764
1434+c, gdbSNP:145034828
1448+c, tdbSNP:145594574
1467+g, tdbSNP:142153837
1468+a, tdbSNP:146217676
1736+c, tdbSNP:147843249
1742+c, tdbSNP:141143951
1758+a, cdbSNP:143425561
1786+a, gdbSNP:148008907
1805+c, tdbSNP:201375554
1808+c, tdbSNP:201646295
1809+a, gdbSNP:201983709
1821+c, tdbSNP:141708903
1872+a, gdbSNP:111905533
1928+c, tdbSNP:10866
1965+c, tdbSNP:3087784
2096+c, gdbSNP:148121766
2116+c, tdbSNP:140982354
2122+c, tdbSNP:13335284
2229+g, tdbSNP:189787811
2315+g, tdbSNP:181078294
2325+a, gdbSNP:113332295
2447+c, tdbSNP:185952911
2552+c, gdbSNP:79745244
2608+c, tdbSNP:138049982
2703+g, tdbSNP:71386677
2707+c, gdbSNP:142512073
2820+c, tdbSNP:190327635
2865+c, tdbSNP:78560075
2886+a, gdbSNP:138756291
2970+c, tdbSNP:76291069
2985+a, gdbSNP:74003037
3028+c, tdbSNP:144433575
3092+c, tdbSNP:148393103
3093+a, gdbSNP:141692563
3108+g, tdbSNP:147153606
3119+c, tdbSNP:183283033
3206+c, tdbSNP:28679688
3295..3297+, tgcdbSNP:149315179
3627+a, gdbSNP:4786296
3720+g, tdbSNP:4786297
3774+a, gdbSNP:147975625
3798..3812+, cctgtgtctccatgtdbSNP:11268185
3844+a, gdbSNP:187363186
3856+c, gdbSNP:28457160
3888+g, tdbSNP:113716221
3919+c, tdbSNP:190975527
4009+a, gdbSNP:113054936
4040+a, gdbSNP:28615548
4130+c, tdbSNP:149131034
4198+c, gdbSNP:71386681
4311..4312+, adbSNP:199508475
4418+c, tdbSNP:147659496
5137+a, gdbSNP:182763560
5247+a, gdbSNP:187478880
5268+c, gdbSNP:112319026
5271+a, cdbSNP:191845035
5276+a, gdbSNP:144753105
5329+a, gdbSNP:182493826
5425+c, tdbSNP:11554593
5489+c, tdbSNP:112703875
5755..5760+, gtggggdbSNP:33994421
5866+c, gdbSNP:56318884
5906+a, gdbSNP:2335110
5986+a, gdbSNP:187543589
6011+c, tdbSNP:2335111
6013+c, tdbSNP:137906061
6091..6092+, ccdbSNP:71776175
6127+c, gdbSNP:3095103
6225+c, tdbSNP:185737005
6235+a, cdbSNP:190542981
6273..6274+, adbSNP:200815032
6303+a, gdbSNP:200359888
6492+c, tdbSNP:929457
6528+a, gdbSNP:201156361
6593+a, gdbSNP:184540154
6594+c, tdbSNP:189062814
6652..6655+, gtaadbSNP:5815128
6655..6658+, agtadbSNP:3030674
6943..6944+, tgdbSNP:201869822
7072+a, gdbSNP:11554591
7141..7142+, ttdbSNP:111618468
7142..7143+, ttdbSNP:71726088
7143+a, gdbSNP:11554592
7148+c, g, tdbSNP:181213412
7152..7153+, tcdbSNP:201698119
7172+a, gdbSNP:185318792
7196+a, tdbSNP:189105574
Gene SymbolPDPK1
Gene SynonymPDK1; PDPK2; PRO0461
Chromosome16
Locus Map16p13.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001261816 Homo sapiens 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 3, mRNA. Full Length $3164.40
ORF Sequence $395.85
NM_002613 Homo sapiens 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1, mRNA. Full Length $3259.35
ORF Sequence $484.59
NM_031268 Homo sapiens 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2, mRNA. Full Length $3087.90
ORF Sequence $374.10
Title A novel regulatory mechanism links PLCgamma1 to PDK1 .
Author Raimondi,C., Chikh,A., Wheeler,A.P., Maffucci,T. and Falasca,M.
Journal J. Cell. Sci. 125 (PT 13), 3153-3163 (2012)
Title PDK1 in apical signaling endosomes participates in the rescue of the polarity complex atypical PKC by intermediate filaments in intestinal epithelia .
Author Mashukova,A., Forteza,R., Wald,F.A. and Salas,P.J.
Journal Mol. Biol. Cell 23 (9), 1664-1674 (2012)
Title Destabilization of PDK1 by Hsp90 inactivation suppresses hepatitis .
Author Kim,M.G., Moon,J.S., Kim,E.J., Lee,S.H. and Oh,J.W.
Journal Biochem. Biophys. Res. Commun. 421 (1), 112-118 (2012)
Title Proliferative and antiapoptotic signaling stimulated by nuclear-localized PDK1 results in oncogenesis .
Author Kikani,C.K., Verona,E.V., Ryu,J., Shen,Y., Ye,Q., Zheng,L., Qian,Z., Sakaue,H., Nakamura,K., Du,J., Ji,Q., Ogawa,W., Sun,L.Z., Dong,L.Q. and Liu,F.
Journal Sci Signal 5 (249), RA80 (2012)
Title Silencing of PDK1 gene expression by RNA interference suppresses growth of esophageal cancer .
Author Yu,J., Chen,K.S., Li,Y.N., Yang,J. and Zhao,L.
Journal Asian Pac. J. Cancer Prev. 13 (8), 4147-4151 (2012)
Title Mitogenic activation, phosphorylation, and nuclear translocation of protein kinase Bbeta .
Author Meier,R., Alessi,D.R., Cron,P., Andjelkovic,M. and Hemmings,B.A.
Journal J. Biol. Chem. 272 (48), 30491-30497 (1997)
Title Further evidence that the inhibition of glycogen synthase kinase-3beta by IGF-1 is mediated by PDK1/PKB-induced phosphorylation of Ser-9 and not by dephosphorylation of Tyr-216 .
Author Shaw,M., Cohen,P. and Alessi,D.R.
Journal FEBS Lett. 416 (3), 307-311 (1997)
Title 3-Phosphoinositide-dependent protein kinase-1 (PDK1): structural and functional homology with the Drosophila DSTPK61 kinase .
Author Alessi,D.R., Deak,M., Casamayor,A., Caudwell,F.B., Morrice,N., Norman,D.G., Gaffney,P., Reese,C.B., MacDougall,C.N., Harbison,D., Ashworth,A. and Bownes,M.
Journal Curr. Biol. 7 (10), 776-789 (1997)
Title Dual requirement for a newly identified phosphorylation site in p70s6k .
Author Moser,B.A., Dennis,P.B., Pullen,N., Pearson,R.B., Williamson,N.A., Wettenhall,R.E., Kozma,S.C. and Thomas,G.
Journal Mol. Cell. Biol. 17 (9), 5648-5655 (1997)
Title Characterization of a 3-phosphoinositide-dependent protein kinase which phosphorylates and activates protein kinase Balpha .
Author Alessi,D.R., James,S.R., Downes,C.P., Holmes,A.B., Gaffney,P.R., Reese,C.B. and Cohen,P.
Journal Curr. Biol. 7 (4), 261-269 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878