• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 (SERPINF1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002615 Homo sapiens serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 (SERPINF1), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_002615.5, 318037587
Length 1552 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 (SERPINF1), mRNA.
Product pigment epithelium-derived factor precursor
Comment

Summary: The protein encoded by this gene is a member of the serpin family, although it does not display the serine protease inhibitory activity shown by many of the other serpin family members. The encoded protein is secreted and strongly inhibits angiogenesis. In addition, this protein is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells.[provided by RefSeq, Mar 2011].

RefSeq NP_002606.3
CDS 158..1414
Misc Feature(1)53..55
Misc Feature(2)53..55
Misc Feature(3)215..217
Misc Feature(4)227..229
Misc Feature(5)275..1402
Misc Feature(6)order(386..397,407..481,512..526)
Misc Feature(7)497..499
Misc Feature(8)836..838
Misc Feature(9)1010..1012
Misc Feature(10)order(1259..1270,1319..1336)
Misc Feature(11)1268..1306
Exon (1)1..149
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (2)150..241
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (3)242..440
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (4)441..596
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (5)597..800
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (6)801..943
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (7)944..1154
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (8)1155..1533
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Translation MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN FGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHG TYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEI NNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVR VPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHD IDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRA GFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
72+a, cdbSNP:9913583
172+g, tdbSNP:139841572
229+c, tdbSNP:141269565
255+a, cdbSNP:11542992
256+c, tdbSNP:150314171
263+a, gdbSNP:137999955
275+a, gdbSNP:149451759
300+a, gdbSNP:143907447
308+a, gdbSNP:150899084
322+a, tdbSNP:143275700
324+c, gdbSNP:76119062
325+a, gdbSNP:140055545
335+a, cdbSNP:79294073
359+c, gdbSNP:143827025
363+a, gdbSNP:151059657
372+c, tdbSNP:1136287
381+c, tdbSNP:149768643
382+a, gdbSNP:146773822
399+c, gdbSNP:140512665
421+a, cdbSNP:11542993
425+c, tdbSNP:11542990
426+c, tdbSNP:144853088
436+g, tdbSNP:147257649
474+dbSNP:
474+c, gdbSNP:148872301
482..483+, ctdbSNP:193302871
538+c, tdbSNP:1804147
547+c, tdbSNP:8074840
549+a, cdbSNP:148005190
550+c, gdbSNP:140801217
552+a, c, gdbSNP:1804145
554+c, gdbSNP:138610575
566+a, gdbSNP:142705862
595+a, gdbSNP:141155058
598+dbSNP:
598+c, gdbSNP:138341386
605+a, gdbSNP:62640873
643+c, tdbSNP:144357336
683+a, gdbSNP:77671583
712+c, tdbSNP:34063250
725+a, gdbSNP:146337776
733+a, cdbSNP:139486861
734+a, gdbSNP:144219428
744+c, tdbSNP:1804148
757+a, cdbSNP:11542991
758+a, gdbSNP:137997656
763+g, tdbSNP:200661635
802+dbSNP:
802+c, gdbSNP:140414882
829+a, gdbSNP:149930177
853+c, gdbSNP:193302872
871+c, tdbSNP:201598729
913+a, cdbSNP:144006481
946+dbSNP:
946+a, tdbSNP:144975917
948..949+, cdbSNP:35390022
967+a, gdbSNP:149088020
983+a, tdbSNP:145833645
997+g, tdbSNP:200114659
1018+c, gdbSNP:138744676
1059+c, tdbSNP:112099952
1070+c, gdbSNP:146939364
1078+c, tdbSNP:202222754
1086+c, tdbSNP:190292375
1103+a, cdbSNP:76282564
1120+c, g, tdbSNP:6828
1126+c, tdbSNP:115672275
1152+c, tdbSNP:150696039
1161+dbSNP:
1161+a, gdbSNP:138875154
1164+c, tdbSNP:142170837
1197+a, cdbSNP:146326833
1222+a, gdbSNP:200343956
1231+c, tdbSNP:139643371
1233+a, gdbSNP:144198046
1236+c, tdbSNP:146075681
1269+c, tdbSNP:201562844
1276+c, gdbSNP:148717983
1289+c, tdbSNP:193302873
1328+a, tdbSNP:201113182
1346+a, gdbSNP:9809
1438+c, tdbSNP:1804146
1451+c, gdbSNP:12103619
1479+c, tdbSNP:184188298
Gene SymbolSERPINF1
Gene SynonymEPC-1; OI12; OI6; PEDF; PIG35
Chromosome17
Locus Map17p13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002615 Homo sapiens serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 (SERPINF1), mRNA. On-demand $699.00 18
Title Pigment epithelium-derived factor (PEDF) varies with body composition and insulin resistance in healthy young people .
Author Sunderland,K.L., Tryggestad,J.B., Wang,J.J., Teague,A.M., Pratt,L.V., Zhang,S.X., Thompson,D.M. and Short,K.R.
Journal J. Clin. Endocrinol. Metab. 97 (11), E2114-E2118 (2012)
Title Adenoviral E4 gene stimulates secretion of pigmental epithelium derived factor (PEDF) that maintains long-term survival of human glomerulus-derived endothelial cells .
Author Jerebtsova,M., Kumari,N., Obuhkov,Y. and Nekhai,S.
Journal Mol. Cell Proteomics 11 (11), 1378-1388 (2012)
Title C1q/TNF-related protein-3 (CTRP-3) and pigment epithelium-derived factor (PEDF) concentrations in patients with type 2 diabetes and metabolic syndrome .
Author Choi,K.M., Hwang,S.Y., Hong,H.C., Yang,S.J., Choi,H.Y., Yoo,H.J., Lee,K.W., Nam,M.S., Park,Y.S., Woo,J.T., Kim,Y.S., Choi,D.S., Youn,B.S. and Baik,S.H.
Journal Diabetes 61 (11), 2932-2936 (2012)
Title PEDF and VEGF plasma level alterations in patients with dry form of age-related degeneration--a possible link to the development of the disease .
Author Machalinska,A., Safranow,K., Mozolewska-Piotrowska,K., Dziedziejko,V. and Karczewicz,D.
Journal Klin Oczna 114 (2), 115-120 (2012)
Title Osteopontin and other regulators of angiogenesis and fibrogenesis in the vitreous from patients with proliferative vitreoretinal disorders .
Author Abu El-Asrar,A.M., Imtiaz Nawaz,M., Kangave,D., Siddiquei,M.M. and Geboes,K.
Journal Mediators Inflamm. 2012, 493043 (2012)
Title Pigment epithelium-derived factor behaves like a noninhibitory serpin. Neurotrophic activity does not require the serpin reactive loop .
Author Becerra,S.P., Sagasti,A., Spinella,P. and Notario,V.
Journal J. Biol. Chem. 270 (43), 25992-25999 (1995)
Title Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence .
Author Adams,M.D., Kerlavage,A.R., Fleischmann,R.D., Fuldner,R.A., Bult,C.J., Lee,N.H., Kirkness,E.F., Weinstock,K.G., Gocayne,J.D., White,O. et al.
Journal Nature 377 (6547 SUPPL), 3-174 (1995)
Title Localization of the gene for pigment epithelium-derived factor (PEDF) to chromosome 17p13.1 and expression in cultured human retinoblastoma cells .
Author Tombran-Tink,J., Pawar,H., Swaroop,A., Rodriguez,I. and Chader,G.J.
Journal Genomics 19 (2), 266-272 (1994)
Title Overexpression of fetal human pigment epithelium-derived factor in Escherichia coli. A functionally active neurotrophic factor .
Author Becerra,S.P., Palmer,I., Kumar,A., Steele,F., Shiloach,J., Notario,V. and Chader,G.J.
Journal J. Biol. Chem. 268 (31), 23148-23156 (1993)
Title Pigment epithelium-derived factor: neurotrophic activity and identification as a member of the serine protease inhibitor gene family .
Author Steele,F.R., Chader,G.J., Johnson,L.V. and Tombran-Tink,J.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (4), 1526-1530 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.