• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 (SERPINF1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002615 Homo sapiens serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 (SERPINF1), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_002615.5, 318037587
Length 1552 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 (SERPINF1), mRNA.
Product pigment epithelium-derived factor precursor
Comment

Summary: The protein encoded by this gene is a member of the serpin family, although it does not display the serine protease inhibitory activity shown by many of the other serpin family members. The encoded protein is secreted and strongly inhibits angiogenesis. In addition, this protein is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells.[provided by RefSeq, Mar 2011].

RefSeq NP_002606.3
CDS 158..1414
Misc Feature(1)53..55
Misc Feature(2)53..55
Misc Feature(3)215..217
Misc Feature(4)227..229
Misc Feature(5)275..1402
Misc Feature(6)order(386..397,407..481,512..526)
Misc Feature(7)497..499
Misc Feature(8)836..838
Misc Feature(9)1010..1012
Misc Feature(10)order(1259..1270,1319..1336)
Misc Feature(11)1268..1306
Exon (1)1..149
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (2)150..241
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (3)242..440
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (4)441..596
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (5)597..800
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (6)801..943
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (7)944..1154
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Exon (8)1155..1533
Gene:SERPINF1
Gene Synonym:EPC-1; OI12; OI6; PEDF; PIG35
Translation MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN FGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHG TYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEI NNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVR VPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHD IDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRA GFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
72+a, cdbSNP:9913583
172+g, tdbSNP:139841572
229+c, tdbSNP:377411384
255+a, cdbSNP:11542992
256+c, tdbSNP:150314171
257+a, gdbSNP:369111028
263+a, gdbSNP:137999955
275..276+, gtdbSNP:398122518
275+a, gdbSNP:149451759
300+a, gdbSNP:143907447
308+a, gdbSNP:150899084
322+a, tdbSNP:143275700
324+c, gdbSNP:76119062
325+a, gdbSNP:140055545
335+a, cdbSNP:79294073
359+c, gdbSNP:143827025
363+a, gdbSNP:151059657
372+c, tdbSNP:1136287
381+c, tdbSNP:149768643
382+a, gdbSNP:146773822
399+c, gdbSNP:140512665
416+a, tdbSNP:373146540
418+a, gdbSNP:375166726
421+a, cdbSNP:11542993
425+c, tdbSNP:11542990
426+c, tdbSNP:144853088
435+c, tdbSNP:369973630
436+g, tdbSNP:147257649
445+dbSNP:
445+g, tdbSNP:373858090
474+c, gdbSNP:148872301
482..483+, ctdbSNP:193302871
538+c, tdbSNP:1804147
546+c, gdbSNP:370469171
547+c, tdbSNP:8074840
549+a, cdbSNP:148005190
550+c, gdbSNP:140801217
552+a, c, gdbSNP:1804145
554+c, gdbSNP:138610575
566+a, gdbSNP:142705862
585+c, tdbSNP:376997671
595+a, gdbSNP:141155058
598+dbSNP:
598+c, gdbSNP:138341386
605+a, gdbSNP:62640873
643+c, tdbSNP:144357336
654+c, tdbSNP:368560431
683+a, gdbSNP:77671583
712+c, tdbSNP:34063250
725+a, gdbSNP:146337776
733+a, cdbSNP:139486861
734+a, gdbSNP:144219428
744+c, tdbSNP:1804148
757+a, cdbSNP:11542991
758+a, gdbSNP:137997656
763+g, tdbSNP:200661635
790+c, gdbSNP:371828832
802+dbSNP:
802+c, gdbSNP:140414882
810+, tdbSNP:398122520
829+a, gdbSNP:149930177
853+c, gdbSNP:193302872
871+c, tdbSNP:201598729
872+a, gdbSNP:376520683
873+g, tdbSNP:375842984
885+a, tdbSNP:371366860
891+c, tdbSNP:374677194
913+a, cdbSNP:144006481
946+dbSNP:
946+a, tdbSNP:144975917
950..951+, cdbSNP:35390022
964+c, tdbSNP:375286670
965+a, gdbSNP:369314029
967+a, gdbSNP:149088020
983+a, tdbSNP:145833645
985+c, tdbSNP:267604755
997+g, tdbSNP:200114659
1018+c, gdbSNP:138744676
1042+c, tdbSNP:373268645
1045+a, gdbSNP:369954662
1050+c, tdbSNP:373375845
1059+c, tdbSNP:112099952
1070+c, gdbSNP:146939364
1078+c, tdbSNP:202222754
1086+c, tdbSNP:190292375
1087+a, gdbSNP:369836889
complement(1103)-c, adbSNP:76282564
1120+c, g, tdbSNP:6828
1126+c, tdbSNP:115672275
1152+c, tdbSNP:150696039
1153+a, gdbSNP:373039314
1161+dbSNP:
1161+a, gdbSNP:138875154
1164+c, tdbSNP:142170837
1197+a, cdbSNP:146326833
1207+c, tdbSNP:367927633
1222+a, gdbSNP:200343956
1231+c, tdbSNP:139643371
1232+c, tdbSNP:371206627
1233+a, gdbSNP:144198046
1236+c, tdbSNP:146075681
1263+c, tdbSNP:368630571
1269+c, tdbSNP:201562844
1276+c, gdbSNP:148717983
1288+a, gdbSNP:372675439
1289+c, tdbSNP:193302873
1312+a, gdbSNP:376648192
1328+a, tdbSNP:201113182
1346+a, gdbSNP:9809
1383+c, tdbSNP:369156271
1395+c, tdbSNP:375149633
1407+a, gdbSNP:369948749
1413+a, gdbSNP:373370053
1438+c, tdbSNP:1804146
1445+a, tdbSNP:373498537
1451+c, gdbSNP:12103619
1479+c, tdbSNP:184188298
Gene SymbolSERPINF1
Gene SynonymEPC-1; OI12; OI6; PEDF; PIG35
Chromosome17
Locus Map17p13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002615 Homo sapiens serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 (SERPINF1), mRNA. On-demand $699.00 18
Title Pigment-Epithelium Derived Factor (PEDF) and the human ovary: a role in the generation of ROS in granulosa cells .
Author Kampfer C, Saller S, Windschuttl S, Berg D, Berg U and Mayerhofer A.
Journal Life Sci. 97 (2), 129-136 (2014)
Title Laminin receptor mediates anti-inflammatory and anti-thrombogenic effects of pigment epithelium-derived factor in myeloma cells .
Author Matsui T, Higashimoto Y and Yamagishi S.
Journal Biochem. Biophys. Res. Commun. 443 (3), 847-851 (2014)
Title Retinoid uptake, processing, and secretion in human iPS-RPE support the visual cycle .
Author Muniz A, Greene WA, Plamper ML, Choi JH, Johnson AJ, Tsin AT and Wang HC.
Journal Invest. Ophthalmol. Vis. Sci. 55 (1), 198-209 (2014)
Title Pigment epithelium-derived factor (PEDF) binds to caveolin-1 and inhibits the pro-inflammatory effects of caveolin-1 in endothelial cells .
Author Matsui T, Higashimoto Y, Taira J and Yamagishi S.
Journal Biochem. Biophys. Res. Commun. 441 (2), 405-410 (2013)
Title Update of the human and mouse SERPIN gene superfamily .
Author Heit C, Jackson BC, McAndrews M, Wright MW, Thompson DC, Silverman GA, Nebert DW and Vasiliou V.
Journal Hum. Genomics 7, 22 (2013)
Title Pigment epithelium-derived factor behaves like a noninhibitory serpin. Neurotrophic activity does not require the serpin reactive loop .
Author Becerra SP, Sagasti A, Spinella P and Notario V.
Journal J. Biol. Chem. 270 (43), 25992-25999 (1995)
Title Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence .
Author Adams MD, Kerlavage AR, Fleischmann RD, Fuldner RA, Bult CJ, Lee NH, Kirkness EF, Weinstock KG, Gocayne JD and White O.
Journal Nature 377 (6547 SUPPL), 3-174 (1995)
Title Localization of the gene for pigment epithelium-derived factor (PEDF) to chromosome 17p13.1 and expression in cultured human retinoblastoma cells .
Author Tombran-Tink J, Pawar H, Swaroop A, Rodriguez I and Chader GJ.
Journal Genomics 19 (2), 266-272 (1994)
Title Overexpression of fetal human pigment epithelium-derived factor in Escherichia coli. A functionally active neurotrophic factor .
Author Becerra SP, Palmer I, Kumar A, Steele F, Shiloach J, Notario V and Chader GJ.
Journal J. Biol. Chem. 268 (31), 23148-23156 (1993)
Title Pigment epithelium-derived factor: neurotrophic activity and identification as a member of the serine protease inhibitor gene family .
Author Steele FR, Chader GJ, Johnson LV and Tombran-Tink J.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (4), 1526-1530 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.