• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens platelet factor 4 (PF4), mRNA.


RefSeq Accession Definition Services Price Order
NM_002619 Homo sapiens platelet factor 4 (PF4), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002619.3, 380254445
Length 878 bp
Structure linear
Update Date 20-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens platelet factor 4 (PF4), mRNA.
Product platelet factor 4 precursor
Comment

Summary: This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is chemotactic for numerous other cell type and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. [provided by RefSeq, Mar 2012].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002610.1
CDS 172..477
Misc Feature(1)136..138
Misc Feature(2)283..471
Misc Feature(3)order(283..291,307..309,319..336,361..369,397..402,
Misc Feature(4)283..291
Misc Feature(5)order(286..288,295..297,334..339,346..354,382..393,
Misc Feature(6)order(286..288,295..297,346..348,352..354,382..384,
Misc Feature(7)order(289..294,298..300)
Misc Feature(8)order(292..294,370..372)
Misc Feature(9)order(295..315,319..336)
Misc Feature(10)order(298..300,418..420)
Misc Feature(11)order(301..306,310..312,319..321,331..333,388..390,
Misc Feature(12)order(322..324,328..330,430..432,439..441,445..456,
Misc Feature(13)order(328..330,337..339,394..396,400..402,409..414)
Misc Feature(14)order(334..339,349..351,385..387,391..393,421..423,
Misc Feature(15)361..369
Misc Feature(16)361..369
Misc Feature(17)400..408
Exon (1)1..262
Gene:PF4
Gene Synonym:CXCL4; PF-4; SCYB4
Exon (2)263..389
Gene:PF4
Gene Synonym:CXCL4; PF-4; SCYB4
Exon (3)390..856
Gene:PF4
Gene Synonym:CXCL4; PF-4; SCYB4
Translation MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(3)-dbSNP:
complement(3)-g, adbSNP:13151226
complement(30)-c, adbSNP:13128069
complement(52)-g, adbSNP:182327392
complement(77)-t, adbSNP:116253707
complement(95)-t, cdbSNP:143069856
complement(103)-t, cdbSNP:1050933
complement(159..160)-g, cdbSNP:1050934
complement(171)-g, cdbSNP:190601797
complement(235)-t, cdbSNP:1804152
complement(244)-t, cdbSNP:116796864
complement(247)-t, gdbSNP:1801572
complement(360)-dbSNP:
complement(360)-g, adbSNP:144253863
complement(380)-g, adbSNP:139635008
complement(387)-g, cdbSNP:2233648
complement(395)-dbSNP:
complement(395)-g, adbSNP:142397385
complement(408)-t, cdbSNP:116188786
complement(411)-g, adbSNP:4694
complement(419)-c, adbSNP:114655702
complement(421)-c, adbSNP:201899718
complement(423)-t, cdbSNP:199976537
complement(426)-g, adbSNP:62313967
complement(445)-t, gdbSNP:148781843
complement(470)-t, cdbSNP:200691269
complement(473)-c, adbSNP:111283987
complement(492)-g, adbSNP:201608869
complement(521)-t, cdbSNP:352006
complement(559)-g, cdbSNP:180789835
complement(616)-g, cdbSNP:11574451
complement(737)-t, gdbSNP:11574452
complement(768)-t, gdbSNP:41265667
complement(770)-t, cdbSNP:352005
complement(798)-c, adbSNP:144889653
complement(828)-t, cdbSNP:352004
Gene SymbolPF4
Gene SynonymCXCL4; PF-4; SCYB4
Chromosome4
Locus Map4q12-q21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002619 Homo sapiens platelet factor 4 (PF4), mRNA. Full Length $254.62
ORF Sequence $159.00
Title Platelet factor 4 and Duffy antigen required for platelet killing of Plasmodium falciparum .
Author McMorran,B.J., Wieczorski,L., Drysdale,K.E., Chan,J.A., Huang,H.M., Smith,C., Mitiku,C., Beeson,J.G., Burgio,G. and Foote,S.J.
Journal Science 338 (6112), 1348-1351 (2012)
Title Genetic variants in platelet factor 4 modulate inflammatory and platelet activation biomarkers .
Author Bhatnagar,P., Lu,X., Evans,M.K., Laveist,T.A., Zonderman,A.B., Carter,D.L., Arking,D.E. and Fletcher,C.A.
Journal Circ Cardiovasc Genet 5 (4), 412-421 (2012)
Title Proteomic analysis reveals platelet factor 4 and beta-thromboglobulin as prognostic markers in severe acute respiratory syndrome .
Author Poon,T.C., Pang,R.T., Chan,K.C., Lee,N.L., Chiu,R.W., Tong,Y.K., Chim,S.S., Ngai,S.M., Sung,J.J. and Lo,Y.M.
Journal Electrophoresis 33 (12), 1894-1900 (2012)
Title Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis .
Author Inouye,M., Ripatti,S., Kettunen,J., Lyytikainen,L.P., Oksala,N., Laurila,P.P., Kangas,A.J., Soininen,P., Savolainen,M.J., Viikari,J., Kahonen,M., Perola,M., Salomaa,V., Raitakari,O., Lehtimaki,T., Taskinen,M.R., Jarvelin,M.R., Ala-Korpela,M., Palotie,A. and de Bakker,P.I.
Journal PLoS Genet. 8 (8), E1002907 (2012)
Title Structural and functional comparison of the genes for human platelet factor 4 and PF4alt .
Author Eisman,R., Surrey,S., Ramachandran,B., Schwartz,E. and Poncz,M.
Journal Blood 76 (2), 336-344 (1990)
Title Cloning and characterization of platelet factor 4 cDNA derived from a human erythroleukemic cell line .
Author Poncz,M., Surrey,S., LaRocco,P., Weiss,M.J., Rappaport,E.F., Conway,T.M. and Schwartz,E.
Journal Blood 69 (1), 219-223 (1987)
Title Primary structure of human platelet factor 4 .
Author Walz,D.A., Wu,V.Y., de Lamo,R., Dene,H. and McCoy,L.E.
Journal Thromb. Res. 11 (6), 893-898 (1977)
Title Isolation, crystallization, and primary amino acid sequence of human platelet factor 4 .
Author Hermodson,M., Schmer,G. and Kurachi,K.
Journal J. Biol. Chem. 252 (18), 6276-6279 (1977)
Title Amino acid sequence of human platelet factor 4 .
Author Deuel,T.F., Keim,P.S., Farmer,M. and Heinrikson,R.L.
Journal Proc. Natl. Acad. Sci. U.S.A. 74 (6), 2256-2258 (1977)
Title Antigenic and antiheparin properties of human platelet factor 4 (PF4) .
Author Nath,N., Lowery,C.T. and Niewiarowski,S.
Journal Blood 45 (4), 537-550 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878