• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens platelet factor 4 (PF4), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002619 Homo sapiens platelet factor 4 (PF4), mRNA. Full Lenth $159.00
ORF Sequence $159.00


RefSeq Version NM_002619.2, 194097423
Length 476 bp
Structure linear
Update Date 13-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens platelet factor 4 (PF4), mRNA.
Product platelet factor 4 precursor
Comment

Summary: Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair (Eisman et al., 1990 [PubMed 1695112]).[supplied by OMIM].

RefSeq NP_002610.1
CDS 46..351
Exon (1)1..136
Exon (2)1..136
Exon (3)137..263
Exon (4)264..476
Translation MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
33..34+c, gdbSNP:1050934
109+c, tdbSNP:1804152
complement(118)-t, cdbSNP:116796864
121+g, tdbSNP:1801572
261+c, gdbSNP:2233648
complement(263)-, largedeletiondbSNP:71802754
complement(282)-t, cdbSNP:116188786
285+a, gdbSNP:4694
complement(293)-c, adbSNP:114655702
complement(300)-g, adbSNP:62313967
complement(347)-c, adbSNP:111283987
395+c, tdbSNP:352006
Gene SymbolPF4
Gene SynonymCXCL4; MGC138298; SCYB4
Chromosome4
Locus Map4q12-q21
All Transcripts NM_002619
Title Platelet factor 4 inhibits thrombomodulin-dependent activation of thrombin-activatable fibrinolysis inhibitor (TAFI) by thrombin .
Author Mosnier,L.O.
Journal J. Biol. Chem. 286 (1), 502-510 (2011)
Title Functional divergence between 2 chemokines is conferred by single amino acid change .
Author Dubrac,A., Quemener,C., Lacazette,E., Lopez,F., Zanibellato,C., Wu,W.G., Bikfalvi,A. and Prats,H.
Journal Blood 116 (22), 4703-4711 (2010)
Title Prevalence of the antiheparin-platelet factor 4 antibody in hemodialysis (HD) patients and its effects upon dialysis access .
Author Wallace,K., Dasgupta,I., Stratton,J., Johnston,P. and Parry,R.
Journal Clin. Nephrol. 74 (5), 409-410 (2010)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Heparin-induced thrombocytopenia: towards standardization of platelet factor 4/heparin antigen tests .
Author Greinacher,A., Ittermann,T., Bagemuhl,J., Althaus,K., Furll,B., Selleng,S., Lubenow,N., Schellong,S., Sheppard,J.I. and Warkentin,T.E.
Journal J. Thromb. Haemost. 8 (9), 2025-2031 (2010)
Title Inhibition of angiogenesis by recombinant human platelet factor-4 and related peptides .
Author Maione,T.E., Gray,G.S., Petro,J., Hunt,A.J., Donner,A.L., Bauer,S.I., Carson,H.F. and Sharpe,R.J.
Journal Science 247 (4938), 77-79 (1990)
Title Primary structure of human platelet factor 4 .
Author Walz,D.A., Wu,V.Y., de Lamo,R., Dene,H. and McCoy,L.E.
Journal Thromb. Res. 11 (6), 893-898 (1977)
Title Isolation, crystallization, and primary amino acid sequence of human platelet factor 4 .
Author Hermodson,M., Schmer,G. and Kurachi,K.
Journal J. Biol. Chem. 252 (18), 6276-6279 (1977)
Title Amino acid sequence of human platelet factor 4 .
Author Deuel,T.F., Keim,P.S., Farmer,M. and Heinrikson,R.L.
Journal Proc. Natl. Acad. Sci. U.S.A. 74 (6), 2256-2258 (1977)
Title Antigenic and antiheparin properties of human platelet factor 4 (PF4) .
Author Nath,N., Lowery,C.T. and Niewiarowski,S.
Journal Blood 45 (4), 537-550 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878