• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens platelet factor 4 (PF4), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21626 Homo sapiens platelet factor 4 (PF4), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu21626C Homo sapiens platelet factor 4 (PF4), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002619.3, 380254445
Length 306 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens platelet factor 4 (PF4), mRNA.
Product platelet factor 4 precursor
Comment

Summary: This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is chemotactic for numerous other cell type and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. [provided by RefSeq, Mar 2012].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002610.1
CDS 172..477
Misc Feature(1)136..138
Misc Feature(2)283..471
Misc Feature(3)order(283..291,307..309,319..336,361..369,397..402,
Misc Feature(4)283..291
Misc Feature(5)order(286..288,295..297,334..339,346..354,382..393,
Misc Feature(6)order(286..288,295..297,346..348,352..354,382..384,
Misc Feature(7)order(289..294,298..300)
Misc Feature(8)order(292..294,370..372)
Misc Feature(9)order(295..315,319..336)
Misc Feature(10)order(298..300,418..420)
Misc Feature(11)order(301..306,310..312,319..321,331..333,388..390,
Misc Feature(12)order(322..324,328..330,430..432,439..441,445..456,
Misc Feature(13)order(328..330,337..339,394..396,400..402,409..414)
Misc Feature(14)order(334..339,349..351,385..387,391..393,421..423,
Misc Feature(15)361..369
Misc Feature(16)361..369
Misc Feature(17)400..408
Misc Feature(18)445..465
Exon (1)1..262
Gene:PF4
Gene Synonym:CXCL4; PF-4; SCYB4
Exon (2)263..389
Gene:PF4
Gene Synonym:CXCL4; PF-4; SCYB4
Exon (3)390..856
Gene:PF4
Gene Synonym:CXCL4; PF-4; SCYB4
Translation MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(3)-dbSNP:
complement(3)-g, adbSNP:13151226
complement(30)-c, adbSNP:13128069
complement(52)-g, adbSNP:182327392
complement(77)-t, adbSNP:116253707
complement(82)-t, cdbSNP:371436633
complement(95)-t, cdbSNP:143069856
103+c, tdbSNP:1050933
complement(151)-g, adbSNP:367691357
159..160+c, gdbSNP:1050934
complement(171)-g, cdbSNP:190601797
235+c, tdbSNP:1804152
complement(244)-t, cdbSNP:116796864
247+g, tdbSNP:1801572
complement(289)-dbSNP:
complement(289)-g, adbSNP:371761255
complement(338)-t, gdbSNP:367951530
complement(360)-g, adbSNP:144253863
complement(365)-g, adbSNP:374382692
complement(376)-t, cdbSNP:370792656
complement(380)-g, adbSNP:139635008
387+c, gdbSNP:2233648
complement(395)-dbSNP:
complement(395)-g, adbSNP:142397385
complement(408)-t, cdbSNP:116188786
411+a, gdbSNP:4694
complement(419)-c, adbSNP:114655702
complement(421)-g, c, adbSNP:201899718
complement(423)-t, cdbSNP:199976537
complement(426)-g, adbSNP:62313967
complement(470)-t, cdbSNP:200691269
complement(473)-c, adbSNP:111283987
complement(492)-g, adbSNP:201608869
complement(514)-t, gdbSNP:373572494
521+c, tdbSNP:352006
complement(559)-g, cdbSNP:180789835
complement(602)-g, adbSNP:375742261
616+c, gdbSNP:11574451
737+g, tdbSNP:11574452
complement(768)-t, gdbSNP:41265667
770+c, tdbSNP:352005
complement(798)-c, adbSNP:144889653
complement(828)-t, cdbSNP:352004
Gene SymbolPF4
Gene SynonymCXCL4; PF-4; SCYB4
Chromosome4
Locus Map4q12-q21
Title Modulation of protein C activation by histones, platelet factor 4, and heparinoids: new insights into activated protein C formation .
Author Kowalska MA, Zhao G, Zhai L, David G 3rd, Marcus S, Krishnaswamy S and Poncz M.
Journal Arterioscler. Thromb. Vasc. Biol. 34 (1), 120-126 (2014)
Title Distinct specificity and single-molecule kinetics characterize the interaction of pathogenic and non-pathogenic antibodies against platelet factor 4-heparin complexes with platelet factor 4 .
Author Litvinov RI, Yarovoi SV, Rauova L, Barsegov V, Sachais BS, Rux AH, Hinds JL, Arepally GM, Cines DB and Weisel JW.
Journal J. Biol. Chem. 288 (46), 33060-33070 (2013)
Title RUNX1, but not its familial platelet disorder mutants, synergistically activates PF4 gene expression in combination with .
Author Okada Y, Watanabe M, Nakai T, Kamikawa Y, Shimizu M, Fukuhara Y, Yonekura M, Matsuura E, Hoshika Y, Nagai R, Aird WC and Doi T.
Journal J. Thromb. Haemost. 11 (9), 1742-1750 (2013)
Title Platelet factor 4-positive thrombi adhering to the ventricles of a ventricular assist device in patients with heparin-induced thrombocytopenia type II .
Author Beiras-Fernandez A, Kanzler I, Michel S, Sadoni S, Kilger E, Beiras
Journal Transplant. Proc. 45 (5), 2013-2016 (2013)
Title Structural and functional comparison of the genes for human platelet factor 4 and PF4alt .
Author Eisman R, Surrey S, Ramachandran B, Schwartz E and Poncz M.
Journal Blood 76 (2), 336-344 (1990)
Title Cloning and characterization of platelet factor 4 cDNA derived from a human erythroleukemic cell line .
Author Poncz,M., Surrey,S., LaRocco,P., Weiss,M.J., Rappaport,E.F., Conway,T.M. and Schwartz,E.
Journal Blood 69 (1), 219-223 (1987)
Title Primary structure of human platelet factor 4 .
Author Walz,D.A., Wu,V.Y., de Lamo,R., Dene,H. and McCoy,L.E.
Journal Thromb. Res. 11 (6), 893-898 (1977)
Title Isolation, crystallization, and primary amino acid sequence of human platelet factor 4 .
Author Hermodson,M., Schmer,G. and Kurachi,K.
Journal J. Biol. Chem. 252 (18), 6276-6279 (1977)
Title Amino acid sequence of human platelet factor 4 .
Author Deuel,T.F., Keim,P.S., Farmer,M. and Heinrikson,R.L.
Journal Proc. Natl. Acad. Sci. U.S.A. 74 (6), 2256-2258 (1977)
Title Antigenic and antiheparin properties of human platelet factor 4 (PF4) .
Author Nath,N., Lowery,C.T. and Niewiarowski,S.
Journal Blood 45 (4), 537-550 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.