• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25445 Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu25445C Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002620.2, 89242144
Length 315 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA.
Product platelet factor 4 variant precursor
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from M26167.1. On Mar 7, 2006 this sequence version replaced gi:4505734.

RefSeq NP_002611.1
CDS 68..382
Misc Feature(1)188..364
Misc Feature(2)order(188..196,212..214,224..241,266..274,302..307,
Misc Feature(3)188..196
Misc Feature(4)order(191..193,200..202,239..244,251..259,287..298,
Misc Feature(5)order(191..193,200..202,251..253,257..259,287..289,
Misc Feature(6)order(194..199,203..205)
Misc Feature(7)order(200..220,224..241)
Misc Feature(8)order(206..211,215..217,224..226,236..238,293..295,
Misc Feature(9)order(227..229,233..235,335..337,344..346,350..361)
Misc Feature(10)order(233..235,242..244,299..301,305..307,314..319)
Misc Feature(11)order(239..244,254..256,290..292,296..298,326..328,
Misc Feature(12)266..274
Misc Feature(13)266..274
Misc Feature(14)305..313
Misc Feature(15)350..370
Exon (1)1..167
Gene:PF4V1
Gene Synonym:CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Exon (2)168..294
Gene:PF4V1
Gene Synonym:CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Exon (3)295..741
Gene:PF4V1
Gene Synonym:CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Translation MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITS LEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
32+dbSNP:
32+g, tdbSNP:199780367
43+a, gdbSNP:367550149
76+c, tdbSNP:185136037
77+g, tdbSNP:145723340
88+a, c, tdbSNP:148247108
137+c, tdbSNP:141256311
187+dbSNP:
187+a, gdbSNP:150334261
202+a, gdbSNP:137995350
233+a, gdbSNP:201845529
236+c, gdbSNP:4812
259+c, tdbSNP:372559874
265+c, tdbSNP:147144357
272+c, tdbSNP:140256823
286+a, cdbSNP:373463793
292+c, gdbSNP:34446485
297+dbSNP:
297+c, tdbSNP:201668251
310+c, tdbSNP:374984634
312+c, gdbSNP:370845013
326+a, tdbSNP:144390629
342+c, tdbSNP:373676570
385+a, gdbSNP:367817715
393+c, tdbSNP:368211122
402+a, gdbSNP:201634449
468+a, gdbSNP:11723868
505..507+, taadbSNP:369380215
506+a, cdbSNP:182187520
555+a, tdbSNP:186908092
628+a, gdbSNP:116599437
741+c, tdbSNP:75241206
Gene SymbolPF4V1
Gene SynonymCXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Chromosome4
Locus Map4q12-q21
Title CXCL4L1-fibstatin cooperation inhibits tumor angiogenesis, lymphangiogenesis and metastasis .
Author Prats AC, Van den Berghe L, Rayssac A, Ainaoui N, Morfoisse F, Pujol F, Legonidec S, Bikfalvi A, Prats H, Pyronnet S and Garmy-Susini B.
Journal Microvasc. Res. 89, 25-33 (2013)
Title Alternative C-terminal helix orientation alters chemokine function: structure of the anti-angiogenic chemokine, CXCL4L1 .
Author Kuo JH, Chen YP, Liu JS, Dubrac A, Quemener C, Prats H, Bikfalvi A, Wu WG and Sue SC.
Journal J. Biol. Chem. 288 (19), 13522-13533 (2013)
Title Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease .
Author Jostins L, Ripke S, Weersma RK, Duerr RH, McGovern DP, Hui KY, Lee JC, Schumm LP, Sharma Y, Anderson CA, Essers J, Mitrovic M, Ning K, Cleynen I, Theatre E, Spain SL, Raychaudhuri S, Goyette P, Wei Z, Abraham C, Achkar JP, Ahmad T, Amininejad L, Ananthakrishnan AN, Andersen V, Andrews JM, Baidoo L, Balschun T, Bampton PA, Bitton A, Boucher G, Brand S, Buning C, Cohain A, Cichon S, D'Amato M, De Jong D, Devaney KL, Dubinsky M, Edwards C, Ellinghaus D, Ferguson LR, Franchimont D, Fransen K, Gearry R, Georges M, Gieger C, Glas J, Haritunians T, Hart A, Hawkey C, Hedl M, Hu X, Karlsen TH, Kupcinskas L, Kugathasan S, Latiano A, Laukens D, Lawrance IC, Lees CW, Louis E, Mahy G, Mansfield J, Morgan AR, Mowat C, Newman W, Palmieri O, Ponsioen CY, Potocnik U, Prescott NJ, Regueiro M, Rotter JI, Russell RK, Sanderson JD, Sans M, Satsangi J, Schreiber S, Simms LA, Sventoraityte J, Targan SR, Taylor KD, Tremelling M, Verspaget HW, De Vos M, Wijmenga C, Wilson DC, Winkelmann J, Xavier RJ, Zeissig S, Zhang B, Zhang CK, Zhao H, Silverberg MS, Annese V, Hakonarson H, Brant SR, Radford-Smith G, Mathew CG, Rioux JD, Schadt EE, Daly MJ, Franke A, Parkes M, Vermeire S, Barrett JC and Cho JH.
Journal Nature 491 (7422), 119-124 (2012)
Title PF-4var/CXCL4L1 predicts outcome in stable coronary artery disease patients with preserved left ventricular function .
Author De Sutter J, Van de Veire NR, Struyf S, Philippe J, De Buyzere M and Van Damme J.
Journal PLoS ONE 7 (2), E31343 (2012)
Title The role of the CXC chemokines platelet factor-4 (CXCL4/PF-4) and its variant (CXCL4L1/PF-4var) in inflammation, angiogenesis and cancer .
Author Vandercappellen J, Van Damme J and Struyf S.
Journal Cytokine Growth Factor Rev. 22 (1), 1-18 (2011)
Title Modulation of cystic fibrosis lung disease by variants in interleukin-8 .
Author Hillian AD, Londono D, Dunn JM, Goddard KA, Pace RG, Knowles MR and Drumm ML.
Journal Genes Immun. 9 (6), 501-508 (2008)
Title Platelets release CXCL4L1, a nonallelic variant of the chemokine platelet factor-4/CXCL4 and potent inhibitor of angiogenesis .
Author Struyf S, Burdick MD, Proost P, Van Damme J and Strieter RM.
Journal Circ. Res. 95 (9), 855-857 (2004)
Title Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides .
Author Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR and Vandekerckhove J.
Journal Nat. Biotechnol. 21 (5), 566-569 (2003)
Title Structural and functional comparison of the genes for human platelet factor 4 and PF4alt .
Author Eisman R, Surrey S, Ramachandran B, Schwartz E and Poncz M.
Journal Blood 76 (2), 336-344 (1990)
Title Identification and characterization of PF4varl, a human gene variant of platelet factor 4 .
Author Green CJ, Charles RS, Edwards BF and Johnson PH.
Journal Mol. Cell. Biol. 9 (4), 1445-1451 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.