• THAT   AND
  • THAT   AND


Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_002620 Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA. Full Lenth $214.89
ORF Sequence $159.00


RefSeq Version NM_002620.2, 89242144
Length 741 bp
Structure linear
Update Date 13-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA.
Product platelet factor 4 variant
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from M26167.1. On Mar 7, 2006 this sequence version replaced gi:4505734.

RefSeq NP_002611.1
CDS 68..382
Exon (1)1..167
Exon (2)1..167
Exon (3)168..294
Exon (4)295..741
Translation MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITS LEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
236+c, gdbSNP:4812
292+c, gdbSNP:34446485
468+a, gdbSNP:11723868
628+a, gdbSNP:116599437
741+c, tdbSNP:75241206
Gene SymbolPF4V1
Gene SynonymCXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Chromosome4
Locus Map4q12-q21
All Transcripts NM_002620
Title Angiostatic and chemotactic activities of the CXC chemokine CXCL4L1 (platelet factor-4 variant) are mediated by CXCR3 .
Author Struyf,S., Salogni,L., Burdick,M.D., Vandercappellen,J., Gouwy,M., Noppen,S., Proost,P., Opdenakker,G., Parmentier,M., Gerard,C., Sozzani,S., Strieter,R.M. and Van Damme,J.
Journal Blood 117 (2), 480-488 (2011)
Title Functional divergence between 2 chemokines is conferred by single amino acid change .
Author Dubrac,A., Quemener,C., Lacazette,E., Lopez,F., Zanibellato,C., Wu,W.G., Bikfalvi,A. and Prats,H.
Journal Blood 116 (22), 4703-4711 (2010)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Modulation of cystic fibrosis lung disease by variants in interleukin-8 .
Author Hillian,A.D., Londono,D., Dunn,J.M., Goddard,K.A., Pace,R.G., Knowles,M.R. and Drumm,M.L.
Journal Genes Immun. 9 (6), 501-508 (2008)
Title Platelets release CXCL4L1, a nonallelic variant of the chemokine platelet factor-4/CXCL4 and potent inhibitor of angiogenesis .
Author Struyf,S., Burdick,M.D., Proost,P., Van Damme,J. and Strieter,R.M.
Journal Circ. Res. 95 (9), 855-857 (2004)
Title Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides .
Author Gevaert,K., Goethals,M., Martens,L., Van Damme,J., Staes,A., Thomas,G.R. and Vandekerckhove,J.
Journal Nat. Biotechnol. 21 (5), 566-569 (2003)
Title Structural and functional comparison of the genes for human platelet factor 4 and PF4alt .
Author Eisman,R., Surrey,S., Ramachandran,B., Schwartz,E. and Poncz,M.
Journal Blood 76 (2), 336-344 (1990)
Title Identification and characterization of PF4varl, a human gene variant of platelet factor 4 .
Author Green,C.J., Charles,R.S., Edwards,B.F. and Johnson,P.H.
Journal Mol. Cell. Biol. 9 (4), 1445-1451 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878