• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA.


RefSeq Accession Definition Services Price Order
NM_002620 Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_002620.2, 89242144
Length 741 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA.
Product platelet factor 4 variant precursor
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from M26167.1. On Mar 7, 2006 this sequence version replaced gi:4505734.

RefSeq NP_002611.1
CDS 68..382
Misc Feature(1)188..364
Misc Feature(2)order(188..196,212..214,224..241,266..274,302..307,
Misc Feature(3)188..196
Misc Feature(4)order(191..193,200..202,239..244,251..259,287..298,
Misc Feature(5)order(191..193,200..202,251..253,257..259,287..289,
Misc Feature(6)order(194..199,203..205)
Misc Feature(7)order(200..220,224..241)
Misc Feature(8)order(206..211,215..217,224..226,236..238,293..295,
Misc Feature(9)order(227..229,233..235,335..337,344..346,350..361)
Misc Feature(10)order(233..235,242..244,299..301,305..307,314..319)
Misc Feature(11)order(239..244,254..256,290..292,296..298,326..328,
Misc Feature(12)266..274
Misc Feature(13)266..274
Misc Feature(14)305..313
Exon (1)1..167
Gene:PF4V1
Gene Synonym:CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Exon (2)168..294
Gene:PF4V1
Gene Synonym:CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Exon (3)295..741
Gene:PF4V1
Gene Synonym:CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Translation MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITS LEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
32+dbSNP:
32+g, tdbSNP:199780367
76+c, tdbSNP:185136037
77+g, tdbSNP:145723340
88+a, c, tdbSNP:148247108
137+c, tdbSNP:141256311
187+dbSNP:
187+a, gdbSNP:150334261
202+a, gdbSNP:137995350
233+a, gdbSNP:201845529
236+c, gdbSNP:4812
265+c, tdbSNP:147144357
272+c, tdbSNP:140256823
292+c, gdbSNP:34446485
297+dbSNP:
297+c, tdbSNP:201668251
326+a, tdbSNP:144390629
402+a, gdbSNP:201634449
468+a, gdbSNP:11723868
506+a, cdbSNP:182187520
555+a, tdbSNP:186908092
628+a, gdbSNP:116599437
741+c, tdbSNP:75241206
Gene SymbolPF4V1
Gene SynonymCXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Chromosome4
Locus Map4q12-q21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_002620 Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA. Full Length $214.89
ORF Sequence $159.00
Title PF-4var/CXCL4L1 predicts outcome in stable coronary artery disease patients with preserved left ventricular function .
Author De Sutter,J., Van de Veire,N.R., Struyf,S., Philippe,J., De Buyzere,M. and Van Damme,J.
Journal PLoS ONE 7 (2), E31343 (2012)
Title The role of the CXC chemokines platelet factor-4 (CXCL4/PF-4) and its variant (CXCL4L1/PF-4var) in inflammation, angiogenesis and cancer .
Author Vandercappellen,J., Van Damme,J. and Struyf,S.
Journal Cytokine Growth Factor Rev. 22 (1), 1-18 (2011)
Title Angiostatic and chemotactic activities of the CXC chemokine CXCL4L1 (platelet factor-4 variant) are mediated by CXCR3 .
Author Struyf,S., Salogni,L., Burdick,M.D., Vandercappellen,J., Gouwy,M., Noppen,S., Proost,P., Opdenakker,G., Parmentier,M., Gerard,C., Sozzani,S., Strieter,R.M. and Van Damme,J.
Journal Blood 117 (2), 480-488 (2011)
Title CXCL4L1 inhibits angiogenesis and induces undirected endothelial cell migration without affecting endothelial cell proliferation and monocyte recruitment .
Author Sarabi,A., Kramp,B.K., Drechsler,M., Hackeng,T.M., Soehnlein,O., Weber,C., Koenen,R.R. and Von Hundelshausen,P.
Journal J. Thromb. Haemost. 9 (1), 209-219 (2011)
Title Functional divergence between 2 chemokines is conferred by single amino acid change .
Author Dubrac,A., Quemener,C., Lacazette,E., Lopez,F., Zanibellato,C., Wu,W.G., Bikfalvi,A. and Prats,H.
Journal Blood 116 (22), 4703-4711 (2010)
Title Modulation of cystic fibrosis lung disease by variants in interleukin-8 .
Author Hillian,A.D., Londono,D., Dunn,J.M., Goddard,K.A., Pace,R.G., Knowles,M.R. and Drumm,M.L.
Journal Genes Immun. 9 (6), 501-508 (2008)
Title Platelets release CXCL4L1, a nonallelic variant of the chemokine platelet factor-4/CXCL4 and potent inhibitor of angiogenesis .
Author Struyf,S., Burdick,M.D., Proost,P., Van Damme,J. and Strieter,R.M.
Journal Circ. Res. 95 (9), 855-857 (2004)
Title Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides .
Author Gevaert,K., Goethals,M., Martens,L., Van Damme,J., Staes,A., Thomas,G.R. and Vandekerckhove,J.
Journal Nat. Biotechnol. 21 (5), 566-569 (2003)
Title Structural and functional comparison of the genes for human platelet factor 4 and PF4alt .
Author Eisman,R., Surrey,S., Ramachandran,B., Schwartz,E. and Poncz,M.
Journal Blood 76 (2), 336-344 (1990)
Title Identification and characterization of PF4varl, a human gene variant of platelet factor 4 .
Author Green,C.J., Charles,R.S., Edwards,B.F. and Johnson,P.H.
Journal Mol. Cell. Biol. 9 (4), 1445-1451 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878