• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens paired-like homeodomain 1 (PITX1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18454 Homo sapiens paired-like homeodomain 1 (PITX1), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu18454C Homo sapiens paired-like homeodomain 1 (PITX1), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_002653.4, 152963643
Length 945 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens paired-like homeodomain 1 (PITX1), mRNA.
Product pituitary homeobox 1
Comment

Summary: This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. [provided by RefSeq, Jul 2008].

RefSeq NP_002644.4
CDS 394..1338
Misc Feature(1)175..177
Misc Feature(2)394..396
Misc Feature(3)394..396
Misc Feature(4)529..531
Misc Feature(5)535..537
Misc Feature(6)661..837
Misc Feature(7)order(661..675,679..681,730..732,748..750,787..789,
Misc Feature(8)order(667..669,676..678,796..798,805..810,817..819)
Misc Feature(9)832..1230
Misc Feature(10)1000..>1215
Misc Feature(11)1216..1272
Misc Feature(12)1231..1272
Misc Feature(13)1249..1263
Exon (1)1..562
Gene:PITX1
Gene Synonym:BFT; CCF; LBNBG; POTX; PTX1
Exon (2)563..795
Gene:PITX1
Gene Synonym:BFT; CCF; LBNBG; POTX; PTX1
Exon (3)796..2383
Gene:PITX1
Gene Synonym:BFT; CCF; LBNBG; POTX; PTX1
Translation MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKER GGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMRE EIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYS YNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNS GLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGL QGPASGLNACQYNS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(119..124)-dbSNP:
complement(119..124)-, ccggctdbSNP:372983845
complement(173)-c, adbSNP:113986847
complement(383)-c, adbSNP:112693031
complement(549)-g, adbSNP:200290396
complement(608)-dbSNP:
complement(608)-g, adbSNP:139844695
complement(644)-t, gdbSNP:201133610
complement(655)-t, gdbSNP:200888898
complement(675)-c, adbSNP:147452369
complement(687)-g, adbSNP:375811840
complement(762)-g, adbSNP:371237885
complement(780)-g, adbSNP:112172425
781+a, gdbSNP:121909109
811+dbSNP:
811+a, cdbSNP:1131611
complement(814)-t, gdbSNP:371250970
complement(892)-g, adbSNP:591552
complement(906)-g, adbSNP:370433085
complement(968)-g, adbSNP:201656428
complement(975)-t, gdbSNP:373414953
complement(993)-g, adbSNP:144193864
complement(994)-g, adbSNP:370544754
complement(1006)-t, gdbSNP:149498254
complement(1013)-g, adbSNP:147021244
complement(1026)-t, cdbSNP:202189745
complement(1030)-t, cdbSNP:138042194
complement(1031)-t, adbSNP:373267473
complement(1039)-c, adbSNP:373526031
complement(1044)-g, cdbSNP:146204449
complement(1065)-g, adbSNP:369693251
complement(1140)-t, gdbSNP:375442916
complement(1159)-t, cdbSNP:372494047
complement(1182)-g, cdbSNP:369214320
complement(1186)-g, cdbSNP:141612135
complement(1251)-t, cdbSNP:138617400
complement(1272)-t, cdbSNP:61751190
1289+c, gdbSNP:479632
complement(1294)-g, adbSNP:367566700
complement(1318)-t, cdbSNP:140746945
complement(1335)-g, adbSNP:374745950
1392+c, tdbSNP:1131614
complement(1395..1400)-, ccgcgcdbSNP:71660434
1550..1551+, adbSNP:70976562
complement(1568..1569)-, gcdbSNP:368142460
complement(1568)-t, cdbSNP:111319441
complement(1634)-g, cdbSNP:191998224
complement(1636)-c, adbSNP:148703077
complement(1637)-t, cdbSNP:13436473
complement(1640..1641)-, acdbSNP:386405033
complement(1648..1649)-, acdbSNP:371734693
complement(1649..1650)-, gtdbSNP:70976561
complement(1701)-t, cdbSNP:115710080
complement(1705)-t, cdbSNP:39599
complement(1775)-g, adbSNP:9327699
complement(1888)-c, adbSNP:187575103
complement(2002)-t, cdbSNP:115751741
complement(2089)-t, cdbSNP:112938656
2129+c, tdbSNP:1051294
complement(2192)-g, adbSNP:116353259
2265+c, tdbSNP:1051297
complement(2276)-c, adbSNP:371961364
Gene SymbolPITX1
Gene SynonymBFT; CCF; LBNBG; POTX; PTX1
Chromosome5
Locus Map5q31.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002653 Homo sapiens paired-like homeodomain 1 (PITX1), mRNA. On-demand $159.00 7-9
Title Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism .
Author Corominas R, Yang X, Lin GN, Kang S, Shen Y, Ghamsari L, Broly M, Rodriguez M, Tam S, Trigg SA, Fan C, Yi S, Tasan M, Lemmens I, Kuang X, Zhao N, Malhotra D, Michaelson JJ, Vacic V, Calderwood MA, Roth FP, Tavernier J, Horvath S, Salehi-Ashtiani K, Korkin D, Sebat J, Hill DE, Hao T, Vidal M and Iakoucheva LM.
Journal Nat Commun 5, 3650 (2014)
Title Genetic variants associated with disordered eating .
Author Wade TD, Gordon S, Medland S, Bulik CM, Heath AC, Montgomery GW and Martin NG.
Journal Int J Eat Disord 46 (6), 594-608 (2013)
Title Liebenberg syndrome is caused by a deletion upstream to the PITX1 gene resulting in transformation of the upper limbs to reflect lower limb characteristics .
Author Al-Qattan MM, Al-Thunayan A, Alabdulkareem I and Al Balwi M.
Journal Gene 524 (1), 65-71 (2013)
Title Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14 .
Author Ruark E, Seal S, McDonald H, Zhang F, Elliot A, Lau K, Perdeaux E, Rapley E, Eeles R, Peto J, Kote-Jarai Z, Muir K, Nsengimana J, Shipley J, Bishop DT, Stratton MR, Easton DF, Huddart RA, Rahman N and Turnbull C.
Journal Nat. Genet. 45 (6), 686-689 (2013)
Title Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture .
Author Berndt SI, Gustafsson S, Magi R, Ganna A, Wheeler E, Feitosa MF, Justice AE, Monda KL, Croteau-Chonka DC, Day FR, Esko T, Fall T, Ferreira T, Gentilini D, Jackson AU, Luan J, Randall JC, Vedantam S, Willer CJ, Winkler TW, Wood AR, Workalemahu T, Hu YJ, Lee SH, Liang L, Lin DY, Min JL, Neale BM, Thorleifsson G, Yang J, Albrecht E, Amin N, Bragg-Gresham JL, Cadby G, den Heijer M, Eklund N, Fischer K, Goel A, Hottenga JJ, Huffman JE, Jarick I, Johansson A, Johnson T, Kanoni S, Kleber ME, Konig IR, Kristiansson K, Kutalik Z, Lamina C, Lecoeur C, Li G, Mangino M, McArdle WL, Medina-Gomez C, Muller-Nurasyid M, Ngwa JS, Nolte IM, Paternoster L, Pechlivanis S, Perola M, Peters MJ, Preuss M, Rose LM, Shi J, Shungin D, Smith AV, Strawbridge RJ, Surakka I, Teumer A, Trip MD, Tyrer J, Van Vliet-Ostaptchouk JV, Vandenput L, Waite LL, Zhao JH, Absher D, Asselbergs FW, Atalay M, Attwood AP, Balmforth AJ, Basart H, Beilby J, Bonnycastle LL, Brambilla P, Bruinenberg M, Campbell H, Chasman DI, Chines PS, Collins FS, Connell JM, Cookson WO, de Faire U, de Vegt F, Dei M, Dimitriou M, Edkins S, Estrada K, Evans DM, Farrall M, Ferrario MM, Ferrieres J, Franke L, Frau F, Gejman PV, Grallert H, Gronberg H, Gudnason V, Hall AS, Hall P, Hartikainen AL, Hayward C, Heard-Costa NL, Heath AC, Hebebrand J, Homuth G, Hu FB, Hunt SE, Hypponen E, Iribarren C, Jacobs KB, Jansson JO, Jula A, Kahonen M, Kathiresan S, Kee F, Khaw KT, Kivimaki M, Koenig W, Kraja AT, Kumari M, Kuulasmaa K, Kuusisto J, Laitinen JH, Lakka TA, Langenberg C, Launer LJ, Lind L, Lindstrom J, Liu J, Liuzzi A, Lokki ML, Lorentzon M, Madden PA, Magnusson PK, Manunta P, Marek D, Marz W, Mateo Leach I, McKnight B, Medland SE, Mihailov E, Milani L, Montgomery GW, Mooser V, Muhleisen TW, Munroe PB, Musk AW, Narisu N, Navis G, Nicholson G, Nohr EA, Ong KK, Oostra BA, Palmer CN, Palotie A, Peden JF, Pedersen N, Peters A, Polasek O, Pouta A, Pramstaller PP, Prokopenko I, Putter C, Radhakrishnan A, Raitakari O, Rendon A, Rivadeneira F, Rudan I, Saaristo TE, Sambrook JG, Sanders AR, Sanna S, Saramies J, Schipf S, Schreiber S, Schunkert H, Shin SY, Signorini S, Sinisalo J, Skrobek B, Soranzo N, Stancakova A, Stark K, Stephens JC, Stirrups K, Stolk RP, Stumvoll M, Swift AJ, Theodoraki EV, Thorand B, Tregouet DA, Tremoli E, Van der Klauw MM, van Meurs JB, Vermeulen SH, Viikari J, Virtamo J, Vitart V, Waeber G, Wang Z, Widen E, Wild SH, Willemsen G, Winkelmann BR, Witteman JC, Wolffenbuttel BH, Wong A, Wright AF, Zillikens MC, Amouyel P, Boehm BO, Boerwinkle E, Boomsma DI, Caulfield MJ, Chanock SJ, Cupples LA, Cusi D, Dedoussis GV, Erdmann J, Eriksson JG, Franks PW, Froguel P, Gieger C, Gyllensten U, Hamsten A, Harris TB, Hengstenberg C, Hicks AA, Hingorani A, Hinney A, Hofman A, Hovingh KG, Hveem K, Illig T, Jarvelin MR, Jockel KH, Keinanen-Kiukaanniemi SM, Kiemeney LA, Kuh D, Laakso M, Lehtimaki T, Levinson DF, Martin NG, Metspalu A, Morris AD, Nieminen MS, Njolstad I, Ohlsson C, Oldehinkel AJ, Ouwehand WH, Palmer LJ, Penninx B, Power C, Province MA, Psaty BM, Qi L, Rauramaa R, Ridker PM, Ripatti S, Salomaa V, Samani NJ, Snieder H, Sorensen TI, Spector TD, Stefansson K, Tonjes A, Tuomilehto J, Uitterlinden AG, Uusitupa M, van der Harst P, Vollenweider P, Wallaschofski H, Wareham NJ, Watkins H, Wichmann HE, Wilson JF, Abecasis GR, Assimes TL, Barroso I, Boehnke M, Borecki IB, Deloukas P, Fox CS, Frayling T, Groop LC, Haritunian T, Heid IM, Hunter D, Kaplan RC, Karpe F, Moffatt MF, Mohlke KL, O'Connell JR, Pawitan Y, Schadt EE, Schlessinger D, Steinthorsdottir V, Strachan DP, Thorsteinsdottir U, van Duijn CM, Visscher PM, Di Blasio AM, Hirschhorn JN, Lindgren CM, Morris AP, Meyre D, Scherag A, McCarthy MI, Speliotes EK, North KE, Loos RJ and Ingelsson E.
Journal Nat. Genet. 45 (5), 501-512 (2013)
Title NeuroD1/beta2 contributes to cell-specific transcription of the proopiomelanocortin gene .
Author Poulin G, Turgeon B and Drouin J.
Journal Mol. Cell. Biol. 17 (11), 6673-6682 (1997)
Title Backfoot is a novel homeobox gene expressed in the mesenchyme of developing hind limb .
Author Shang J, Luo Y and Clayton DA.
Journal Dev. Dyn. 209 (2), 242-253 (1997)
Title Backfoot, a novel homeobox gene, maps to human chromosome 5 (BFT) and mouse chromosome 13 (Bft) .
Author Shang J, Li X, Ring HZ, Clayton DA and Francke U.
Journal Genomics 40 (1), 108-113 (1997)
Title Human and murine PTX1/Ptx1 gene maps to the region for Treacher Collins syndrome .
Author Crawford MJ, Lanctot C, Tremblay JJ, Jenkins N, Gilbert D, Copeland N, Beatty B and Drouin J.
Journal Mamm. Genome 8 (11), 841-845 (1997)
Title P-OTX: a PIT-1-interacting homeodomain factor expressed during anterior pituitary gland development .
Author Szeto DP, Ryan AK, O'Connell SM and Rosenfeld MG.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (15), 7706-7710 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.