Homo sapiens POU class 2 homeobox 2 (POU2F2), mRNA.
| RefSeq Version | NM_002698.2, 95147338 |
| Length | 4513 bp |
| Structure | linear |
| Update Date | 09-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens POU class 2 homeobox 2 (POU2F2), mRNA. |
| Product | POU domain, class 2, transcription factor 2 |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CB995118.1, BC006101.1, M36718.1 and AC022515.5. On May 13, 2006 this sequence version replaced gi:4505958. |
| RefSeq | NP_002689.1 |
| CDS | 68..1459 | Exon (1) | 1..95 | Exon (2) | 1..95 | Exon (3) | 96..161 | Exon (4) | 162..196 | Exon (5) | 197..253 | Exon (6) | 254..370 | Exon (7) | 371..476 | Exon (8) | 477..568 | Exon (9) | 569..682 | Exon (10) | 683..824 | Exon (11) | 825..973 | Exon (12) | 974..1150 | Exon (13) | 1151..1217 | Exon (14) | 1218..1419 | Exon (15) | 1420..4513 |
| Translation | MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPS
TKIKAEDPSGDSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHL
QPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQPPKCLEPPSHPEE
PSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCK
LKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSF
LANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSAAPMLPSPGKPASYSPH
MVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGGGGGGAAPPLNSIPSVT
PPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(269) | - | g, a | dbSNP:113697394 |
| complement(368) | - | t, c | dbSNP:113689861 |
| complement(1396) | - | c, a | dbSNP:117933480 |
| complement(1727) | - | g, c | dbSNP:112365002 |
| complement(1757) | - | g, c | dbSNP:77440662 |
| complement(1899..1900) | - | , ttttttttttt | dbSNP:60030513 |
| complement(1905..1906) | - | , ttttttttttt | dbSNP:71988556 |
| complement(1917) | - | t, c | dbSNP:76463777 |
| complement(1922) | - | t, c | dbSNP:118038821 |
| complement(1927) | - | t, a | dbSNP:117819712 |
| complement(2011) | - | t, c | dbSNP:75145135 |
| complement(2021) | - | t, g | dbSNP:77259060 |
| complement(2040) | - | t, g | dbSNP:77924883 |
| complement(2043) | - | t, g | dbSNP:79592714 |
| complement(2113) | - | t, c | dbSNP:114156631 |
| complement(2269) | - | t, g | dbSNP:76335122 |
| complement(2680) | - | g, c | dbSNP:11878811 |
| complement(2794..2796) | - | , ttt | dbSNP:79171838 |
| complement(2806) | - | , t | dbSNP:112806215 |
| complement(2869) | - | t, g | dbSNP:117672928 |
| complement(3016) | - | g, c | dbSNP:117557796 |
| complement(3120) | - | g, a | dbSNP:77074519 |
| 3250 | + | a, t | dbSNP:1062539 |
| complement(3263) | - | t, a | dbSNP:62119601 |
| complement(3276) | - | t, c | dbSNP:113904652 |
| 3277 | + | a, c | dbSNP:1714253 |
| complement(3447) | - | g, a | dbSNP:16975663 |
| complement(3887) | - | g, c | dbSNP:73932872 |
| complement(3894) | - | t, g | dbSNP:116591517 |
| complement(3917) | - | g, a | dbSNP:111777852 |
| complement(4089) | - | g, a | dbSNP:10425682 |
| complement(4160) | - | t, c | dbSNP:115694221 |
| complement(4233) | - | g, a | dbSNP:10425402 |
| complement(4494) | - | t, c | dbSNP:79967305 |
| Gene Symbol | POU2F2 |
| Gene Synonym | Oct-2; OCT2; OTF2 |
| Chromosome | 19 |
| Locus Map | 19q13.2 |
| All Transcripts | NM_002698 |
| Title | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study . |
| Author | Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S. |
| Journal | Diabetes Care 33 (10), 2250-2253 (2010) |
| Title | Functional characterization of gefitinib uptake in non-small cell lung cancer cell lines . |
| Author | Galetti,M., Alfieri,R.R., Cavazzoni,A., La Monica,S., Bonelli,M., Fumarola,C., Mozzoni,P., De Palma,G., Andreoli,R., Mutti,A., Mor,M., Tiseo,M., Ardizzoni,A. and Petronini,P.G. |
| Journal | Biochem. Pharmacol. 80 (2), 179-187 (2010) |
| Title | OCT-2 expression and OCT-2/BOB.1 co-expression predict prognosis in patients with newly diagnosed acute myeloid leukemia . |
| Author | Advani,A.S., Lim,K., Gibson,S., Shadman,M., Jin,T., Copelan,E., Kalaycio,M., Sekeres,M.A., Sobecks,R. and Hsi,E. |
| Journal | Leuk. Lymphoma 51 (4), 606-612 (2010) |
| Title | Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip . |
| Author | Talmud,P.J., Drenos,F., Shah,S., Shah,T., Palmen,J., Verzilli,C., Gaunt,T.R., Pallas,J., Lovering,R., Li,K., Casas,J.P., Sofat,R., Kumari,M., Rodriguez,S., Johnson,T., Newhouse,S.J., Dominiczak,A., Samani,N.J., Caulfield,M., Sever,P., Stanton,A., Shields,D.C., Padmanabhan,S., Melander,O., Hastie,C., Delles,C., Ebrahim,S., Marmot,M.G., Smith,G.D., Lawlor,D.A., Munroe,P.B., Day,I.N., Kivimaki,M., Whittaker,J., Humphries,S.E. and Hingorani,A.D. |
| Journal | Am. J. Hum. Genet. 85 (5), 628-642 (2009) |
| Title | Contribution of organic cation transporter 2 (OCT2) to cisplatin-induced nephrotoxicity . |
| Author | Filipski,K.K., Mathijssen,R.H., Mikkelsen,T.S., Schinkel,A.H. and Sparreboom,A. |
| Journal | Clin. Pharmacol. Ther. 86 (4), 396-402 (2009) |
| Title | Transcription factor Oct-2A contains functionally redundant activating domains and works selectively from a promoter but not from a remote enhancer position in non-lymphoid (HeLa) cells . |
| Author | Muller-Immergluck,M.M., Schaffner,W. and Matthias,P. |
| Journal | EMBO J. 9 (5), 1625-1634 (1990) |
| Title | A human lymphoid-specific transcription factor that activates immunoglobulin genes is a homoeobox protein . |
| Author | Scheidereit,C., Cromlish,J.A., Gerster,T., Kawakami,K., Balmaceda,C.G., Currie,R.A. and Roeder,R.G. |
| Journal | Nature 336 (6199), 551-557 (1988) |
| Title | A cloned octamer transcription factor stimulates transcription from lymphoid-specific promoters in non-B cells . |
| Author | Muller,M.M., Ruppert,S., Schaffner,W. and Matthias,P. |
| Journal | Nature 336 (6199), 544-551 (1988) |
| Title | The B-cell-specific Oct-2 protein contains POU box- and homeo box-type domains . |
| Author | Clerc,R.G., Corcoran,L.M., LeBowitz,J.H., Baltimore,D. and Sharp,P.A. |
| Journal | Genes Dev. 2 (12A), 1570-1581 (1988) |
| Title | A human protein specific for the immunoglobulin octamer DNA motif contains a functional homeobox domain . |
| Author | Ko,H.S., Fast,P., McBride,W. and Staudt,L.M. |
| Journal | Cell 55 (1), 135-144 (1988) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |