• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23258 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu23258C Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_002698.4, 351542188
Length 1392 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA.
Product POU domain, class 2, transcription factor 2 isoform 2
Comment

Summary: The protein encoded by this gene is a homeobox-containing transcription factor of the POU domain family. The encoded protein binds the octamer sequence 5'-ATTTGCAT-3', a common transcription factor binding site in immunoglobulin gene promoters. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011].


Transcript Variant: This variant (2) uses an alternate in-frame splice junction at the 5' end of an exon compared to variant 1. The resulting isoform (2) has the same N- and C-termini but is shorter compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002689.1
CDS 63..1454
Misc Feature(1)24..26
Misc Feature(2)24..26
Misc Feature(3)597..821
Misc Feature(4)597..821
Misc Feature(5)906..1076
Misc Feature(6)order(906..920,924..926,975..977,993..995,1032..1034,
Misc Feature(7)order(912..914,921..923,1041..1043,1050..1055,1062..1064)
Exon (1)1..90
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (2)91..156
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (3)157..191
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (4)192..248
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (5)249..365
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (6)366..471
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (7)472..563
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (8)564..677
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (9)678..819
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (10)820..968
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (11)969..1145
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (12)1146..1212
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (13)1213..1414
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (14)1415..6896
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Translation MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPS TKIKAEDPSGDSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHL QPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQPPKCLEPPSHPEE PSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCK LKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSF LANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSAAPMLPSPGKPASYSPH MVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGGGGGGAAPPLNSIPSVT PPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(33)-g, adbSNP:371039226
complement(61)-t, cdbSNP:373375555
complement(83)-g, cdbSNP:201035439
complement(103)-dbSNP:
complement(103)-g, adbSNP:202021860
complement(119)-g, adbSNP:145518520
complement(135)-t, cdbSNP:149684085
complement(142)-g, adbSNP:140322079
complement(143)-t, adbSNP:373677672
complement(208)-dbSNP:
complement(208)-g, adbSNP:372088467
complement(231)-t, cdbSNP:373198280
complement(235)-t, cdbSNP:147555913
complement(264)-dbSNP:
complement(264)-g, adbSNP:113697394
complement(265)-g, cdbSNP:145313361
complement(282)-t, gdbSNP:369000179
complement(339)-t, cdbSNP:139761991
complement(346)-g, adbSNP:150784596
complement(363)-t, cdbSNP:113689861
complement(425)-dbSNP:
complement(425)-t, cdbSNP:376769120
complement(463)-t, cdbSNP:141261459
complement(479)-dbSNP:
complement(479)-t, gdbSNP:148654132
complement(482)-t, cdbSNP:375042716
complement(492)-t, gdbSNP:200919726
complement(526)-g, adbSNP:144295200
complement(549)-t, cdbSNP:142832761
complement(568)-dbSNP:
complement(568)-t, gdbSNP:200544374
complement(764)-dbSNP:
complement(764)-g, adbSNP:138243265
complement(823)-dbSNP:
complement(823)-g, adbSNP:373127616
complement(851)-g, adbSNP:145633555
complement(874)-g, cdbSNP:369381206
complement(879)-t, cdbSNP:368762837
complement(899)-g, adbSNP:375184543
complement(914)-t, cdbSNP:373724008
complement(999)-dbSNP:
complement(999)-g, adbSNP:142293929
complement(1025)-t, cdbSNP:374063683
complement(1049)-g, adbSNP:369799078
complement(1094)-t, cdbSNP:192872020
complement(1165)-dbSNP:
complement(1165)-g, adbSNP:200445754
complement(1172)-g, cdbSNP:372373896
complement(1178)-t, cdbSNP:375995375
complement(1333)-dbSNP:
complement(1333)-g, adbSNP:185988799
complement(1378)-g, adbSNP:377011370
complement(1385)-g, adbSNP:372097777
complement(1390..1391)-, aadbSNP:371927380
complement(1391)-c, adbSNP:367613289
complement(1456)-dbSNP:
complement(1456)-t, cdbSNP:202057376
complement(1461)-g, adbSNP:189815822
complement(1503)-g, adbSNP:371016879
complement(1533)-c, adbSNP:185663006
complement(1603..1604)-, ccccccccdbSNP:374086570
complement(1686)-g, adbSNP:375640794
complement(1704)-g, adbSNP:146890196
complement(1722)-g, cdbSNP:112365002
complement(1746)-t, cdbSNP:371340400
complement(1894..1895)-, tttttttttttdbSNP:60030513
complement(1917)-t, cdbSNP:201334466
complement(1917)-t, cdbSNP:386455897
complement(2035)-t, gdbSNP:77924883
complement(2038)-t, gdbSNP:79592714
complement(2061)-t, adbSNP:181381940
complement(2108)-t, cdbSNP:188984758
complement(2193)-t, gdbSNP:184578212
complement(2205)-, gdbSNP:369101360
complement(2205)-g, adbSNP:182478152
complement(2239)-g, adbSNP:147763868
complement(2264)-t, gdbSNP:76335122
complement(2310)-t, cdbSNP:190504455
complement(2371)-t, cdbSNP:184414066
complement(2675)-g, cdbSNP:11878811
complement(2758)-t, cdbSNP:192508022
complement(2764)-t, adbSNP:374501249
complement(2789..2791)-, tttdbSNP:79171838
complement(2801)-, tdbSNP:112806215
complement(2837)-t, cdbSNP:186989719
complement(2931)-g, cdbSNP:184209215
complement(3043)-g, adbSNP:370420379
complement(3051)-t, cdbSNP:192016538
complement(3109)-g, adbSNP:187584331
complement(3115)-g, adbSNP:77074519
complement(3158)-g, adbSNP:183537927
complement(3202)-g, adbSNP:376049079
3245+a, tdbSNP:1062539
complement(3258)-t, adbSNP:62119601
complement(3271)-t, cdbSNP:113904652
3272+a, cdbSNP:1714253
complement(3294..3295)-, tadbSNP:367858814
complement(3442)-g, adbSNP:16975663
complement(3490)-t, cdbSNP:369226474
complement(3560)-t, adbSNP:370384690
complement(3651)-g, adbSNP:192214862
complement(3676)-t, gdbSNP:375388888
complement(3882)-g, cdbSNP:73932872
complement(3889)-t, gdbSNP:201140249
complement(3912)-g, adbSNP:111777852
complement(3943)-t, cdbSNP:376285271
complement(4021)-t, cdbSNP:139504468
complement(4064)-g, adbSNP:188930221
complement(4084)-g, adbSNP:10425682
complement(4155)-t, cdbSNP:115694221
complement(4228)-g, adbSNP:10425402
complement(4314)-g, adbSNP:150970302
complement(4372)-t, gdbSNP:374338152
complement(4375)-t, adbSNP:371395919
complement(4508)-, tdbSNP:371257414
complement(4682)-g, cdbSNP:182848801
complement(4792)-g, adbSNP:142612497
complement(4845)-c, adbSNP:148445312
complement(4858)-g, cdbSNP:189733752
complement(4860)-g, adbSNP:185318882
complement(5054)-c, adbSNP:1152712
complement(5054)-c, adbSNP:386518669
complement(5460)-t, cdbSNP:369427283
complement(5465)-c, adbSNP:79731015
complement(5510)-c, adbSNP:181257292
complement(5620)-t, gdbSNP:190390746
complement(5674)-t, cdbSNP:386514427
5674+c, tdbSNP:1056995
complement(5762)-g, cdbSNP:62119600
complement(5770)-t, cdbSNP:373294298
complement(5903)-t, cdbSNP:186883572
complement(5940)-t, adbSNP:199950294
complement(5962)-g, adbSNP:369177242
complement(6304..6305)-, gadbSNP:200127549
complement(6314)-t, cdbSNP:181862330
complement(6521)-t, cdbSNP:3760642
complement(6644)-t, gdbSNP:12992
complement(6677)-t, cdbSNP:141823307
complement(6686..6687)-, gdbSNP:35323636
complement(6791)-t, cdbSNP:369657408
Gene SymbolPOU2F2
Gene SynonymOct-2; OCT2; OTF2
Chromosome19
Locus Map19q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002698 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. On-demand TBD TBD
NM_002698 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. On-demand TBD TBD
NM_002698 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. On-demand TBD TBD
NM_002698 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. On-demand TBD TBD
NM_002698 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. On-demand TBD TBD
NM_002698 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. On-demand TBD TBD
NM_002698 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. On-demand TBD TBD
NM_002698 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. On-demand TBD TBD
Title Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma .
Author Li H, Kaminski MS, Li Y, Yildiz M, Ouillette P, Jones S, Fox H, Jacobi K, Saiya-Cork K, Bixby D, Lebovic D, Roulston D, Shedden K, Sabel M, Marentette L, Cimmino V, Chang AE and Malek SN.
Journal Blood 123 (10), 1487-1498 (2014)
Title Immunohistochemical expression of Mum-1, Oct-2 and Bcl-6 in systemic anaplastic large cell lymphomas .
Author Saglam A and Uner AH.
Journal Tumori 97 (5), 634-638 (2011)
Title B-cell transcription factors Pax-5, Oct-2, BOB.1, Bcl-6, and MUM1 are useful markers for the diagnosis of nodular lymphocyte predominant Hodgkin lymphoma .
Author Herbeck R, Teodorescu Brinzeu D, Giubelan M, Lazar E, Dema A and Ionita H.
Journal Rom J Morphol Embryol 52 (1), 69-74 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B, Yusuf S, Gerstein HC, Engert JC and Anand S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Functional characterization of gefitinib uptake in non-small cell lung cancer cell lines .
Author Galetti M, Alfieri RR, Cavazzoni A, La Monica S, Bonelli M, Fumarola C, Mozzoni P, De Palma G, Andreoli R, Mutti A, Mor M, Tiseo M, Ardizzoni A and Petronini PG.
Journal Biochem. Pharmacol. 80 (2), 179-187 (2010)
Title Transcription factor Oct-2A contains functionally redundant activating domains and works selectively from a promoter but not from a remote enhancer position in non-lymphoid (HeLa) cells .
Author Muller-Immergluck MM, Schaffner W and Matthias P.
Journal EMBO J. 9 (5), 1625-1634 (1990)
Title A human lymphoid-specific transcription factor that activates immunoglobulin genes is a homoeobox protein .
Author Scheidereit C, Cromlish JA, Gerster T, Kawakami K, Balmaceda CG, Currie RA and Roeder RG.
Journal Nature 336 (6199), 551-557 (1988)
Title A cloned octamer transcription factor stimulates transcription from lymphoid-specific promoters in non-B cells .
Author Muller MM, Ruppert S, Schaffner W and Matthias P.
Journal Nature 336 (6199), 544-551 (1988)
Title The B-cell-specific Oct-2 protein contains POU box- and homeo box-type domains .
Author Clerc RG, Corcoran LM, LeBowitz JH, Baltimore D and Sharp PA.
Journal Genes Dev. 2 (12A), 1570-1581 (1988)
Title A human protein specific for the immunoglobulin octamer DNA motif contains a functional homeobox domain .
Author Ko HS, Fast P, McBride W and Staudt LM.
Journal Cell 55 (1), 135-144 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.