• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002698 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_002698.4, 351542188
Length 6904 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA.
Product POU domain, class 2, transcription factor 2 isoform 2
Comment

Summary: The protein encoded by this gene is a homeobox-containing transcription factor of the POU domain family. The encoded protein binds the octamer sequence 5'-ATTTGCAT-3', a common transcription factor binding site in immunoglobulin gene promoters. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011].


Transcript Variant: This variant (2) uses an alternate in-frame splice junction at the 5' end of an exon compared to variant 1. The resulting isoform (2) has the same N- and C-termini but is shorter compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_002689.1
CDS 63..1454
Misc Feature(1)24..26
Misc Feature(2)24..26
Misc Feature(3)597..821
Misc Feature(4)597..821
Misc Feature(5)906..1076
Misc Feature(6)order(906..920,924..926,975..977,993..995,1032..1034,
Misc Feature(7)order(912..914,921..923,1041..1043,1050..1055,1062..1064)
Exon (1)1..90
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (2)91..156
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (3)157..191
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (4)192..248
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (5)249..365
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (6)366..471
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (7)472..563
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (8)564..677
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (9)678..819
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (10)820..968
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (11)969..1145
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (12)1146..1212
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (13)1213..1414
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Exon (14)1415..6896
Gene:POU2F2
Gene Synonym:Oct-2; OCT2; OTF2
Translation MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPS TKIKAEDPSGDSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHL QPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQPPKCLEPPSHPEE PSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCK LKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSF LANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSAAPMLPSPGKPASYSPH MVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGGGGGGAAPPLNSIPSVT PPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(83)-g, cdbSNP:201035439
complement(103)-dbSNP:
complement(103)-g, adbSNP:202021860
complement(119)-g, adbSNP:145518520
complement(135)-t, cdbSNP:149684085
complement(142)-g, adbSNP:140322079
complement(235)-dbSNP:
complement(235)-t, cdbSNP:147555913
complement(264)-dbSNP:
complement(264)-g, adbSNP:113697394
complement(265)-g, cdbSNP:145313361
complement(339)-t, cdbSNP:139761991
complement(346)-g, adbSNP:150784596
complement(363)-t, cdbSNP:113689861
complement(463)-dbSNP:
complement(463)-t, cdbSNP:141261459
complement(479)-dbSNP:
complement(479)-t, gdbSNP:148654132
complement(492)-t, gdbSNP:200919726
complement(526)-g, adbSNP:144295200
complement(549)-t, cdbSNP:142832761
complement(568)-dbSNP:
complement(568)-t, gdbSNP:200544374
complement(764)-dbSNP:
complement(764)-g, adbSNP:138243265
complement(851)-dbSNP:
complement(851)-g, adbSNP:145633555
complement(999)-dbSNP:
complement(999)-g, adbSNP:142293929
complement(1094)-t, cdbSNP:192872020
complement(1165)-dbSNP:
complement(1165)-g, adbSNP:200445754
complement(1333)-dbSNP:
complement(1333)-g, adbSNP:185988799
complement(1456)-dbSNP:
complement(1456)-t, cdbSNP:202057376
complement(1461)-g, adbSNP:189815822
complement(1533)-c, adbSNP:185663006
complement(1704)-g, adbSNP:146890196
complement(1722)-g, cdbSNP:112365002
complement(1910..1911)-, tttttttttttdbSNP:60030513
complement(1917)-t, cdbSNP:201334466
complement(2035)-t, gdbSNP:77924883
complement(2038)-t, gdbSNP:79592714
complement(2061)-t, adbSNP:181381940
complement(2108)-t, cdbSNP:188984758
complement(2193)-t, gdbSNP:184578212
complement(2205)-g, adbSNP:182478152
complement(2239)-g, adbSNP:147763868
complement(2264)-t, gdbSNP:76335122
complement(2310)-t, cdbSNP:190504455
complement(2371)-t, cdbSNP:184414066
complement(2675)-g, cdbSNP:11878811
complement(2758)-t, cdbSNP:192508022
complement(2799..2801)-, tttdbSNP:79171838
complement(2801)-, tdbSNP:112806215
complement(2837)-t, cdbSNP:186989719
complement(2931)-g, cdbSNP:184209215
complement(3051)-t, cdbSNP:192016538
complement(3109)-g, adbSNP:187584331
complement(3115)-g, adbSNP:77074519
complement(3158)-g, adbSNP:183537927
complement(3245)-t, adbSNP:1062539
complement(3258)-t, adbSNP:62119601
complement(3271)-t, cdbSNP:113904652
complement(3272)-c, adbSNP:1714253
complement(3442)-g, adbSNP:16975663
complement(3651)-g, adbSNP:192214862
complement(3882)-g, cdbSNP:73932872
complement(3889)-t, gdbSNP:201140249
complement(3912)-g, adbSNP:111777852
complement(4021)-t, cdbSNP:139504468
complement(4064)-g, adbSNP:188930221
complement(4084)-g, adbSNP:10425682
complement(4155)-t, cdbSNP:115694221
complement(4228)-g, adbSNP:10425402
complement(4314)-g, adbSNP:150970302
complement(4682)-g, cdbSNP:182848801
complement(4792)-g, adbSNP:142612497
complement(4845)-c, adbSNP:148445312
complement(4858)-g, cdbSNP:189733752
complement(4860)-g, adbSNP:185318882
complement(5054)-c, adbSNP:1152712
complement(5465)-c, adbSNP:79731015
complement(5510)-c, adbSNP:181257292
complement(5620)-t, gdbSNP:190390746
complement(5674)-t, cdbSNP:1056995
complement(5762)-g, cdbSNP:62119600
complement(5903)-t, cdbSNP:186883572
complement(5940)-t, adbSNP:199950294
complement(6304..6305)-, gadbSNP:200127549
complement(6314)-t, cdbSNP:181862330
complement(6521)-t, cdbSNP:3760642
complement(6644)-t, gdbSNP:12992
complement(6677)-t, cdbSNP:141823307
complement(6686..6687)-, gdbSNP:35323636
Gene SymbolPOU2F2
Gene SynonymOct-2; OCT2; OTF2
Chromosome19
Locus Map19q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001207025 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 1, mRNA. On-demand TBD TBD
NM_001207026 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 3, mRNA. On-demand TBD TBD
NM_001247994 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 4, mRNA. On-demand $549.00 14
NM_002698 Homo sapiens POU class 2 homeobox 2 (POU2F2), transcript variant 2, mRNA. On-demand TBD TBD
Title Immunohistochemical expression of Mum-1, Oct-2 and Bcl-6 in systemic anaplastic large cell lymphomas .
Author Saglam,A. and Uner,A.H.
Journal Tumori 97 (5), 634-638 (2011)
Title B-cell transcription factors Pax-5, Oct-2, BOB.1, Bcl-6, and MUM1 are useful markers for the diagnosis of nodular lymphocyte predominant Hodgkin lymphoma .
Author Herbeck,R., Teodorescu Brinzeu,D., Giubelan,M., Lazar,E., Dema,A. and Ionita,H.
Journal Rom J Morphol Embryol 52 (1), 69-74 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Functional characterization of gefitinib uptake in non-small cell lung cancer cell lines .
Author Galetti,M., Alfieri,R.R., Cavazzoni,A., La Monica,S., Bonelli,M., Fumarola,C., Mozzoni,P., De Palma,G., Andreoli,R., Mutti,A., Mor,M., Tiseo,M., Ardizzoni,A. and Petronini,P.G.
Journal Biochem. Pharmacol. 80 (2), 179-187 (2010)
Title OCT-2 expression and OCT-2/BOB.1 co-expression predict prognosis in patients with newly diagnosed acute myeloid leukemia .
Author Advani,A.S., Lim,K., Gibson,S., Shadman,M., Jin,T., Copelan,E., Kalaycio,M., Sekeres,M.A., Sobecks,R. and Hsi,E.
Journal Leuk. Lymphoma 51 (4), 606-612 (2010)
Title Transcription factor Oct-2A contains functionally redundant activating domains and works selectively from a promoter but not from a remote enhancer position in non-lymphoid (HeLa) cells .
Author Muller-Immergluck,M.M., Schaffner,W. and Matthias,P.
Journal EMBO J. 9 (5), 1625-1634 (1990)
Title A human lymphoid-specific transcription factor that activates immunoglobulin genes is a homoeobox protein .
Author Scheidereit,C., Cromlish,J.A., Gerster,T., Kawakami,K., Balmaceda,C.G., Currie,R.A. and Roeder,R.G.
Journal Nature 336 (6199), 551-557 (1988)
Title A cloned octamer transcription factor stimulates transcription from lymphoid-specific promoters in non-B cells .
Author Muller,M.M., Ruppert,S., Schaffner,W. and Matthias,P.
Journal Nature 336 (6199), 544-551 (1988)
Title The B-cell-specific Oct-2 protein contains POU box- and homeo box-type domains .
Author Clerc,R.G., Corcoran,L.M., LeBowitz,J.H., Baltimore,D. and Sharp,P.A.
Journal Genes Dev. 2 (12A), 1570-1581 (1988)
Title A human protein specific for the immunoglobulin octamer DNA motif contains a functional homeobox domain .
Author Ko,H.S., Fast,P., McBride,W. and Staudt,L.M.
Journal Cell 55 (1), 135-144 (1988)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.