• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 3 homeobox 1 (POU3F1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002699 Homo sapiens POU class 3 homeobox 1 (POU3F1), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_002699.3, 110624764
Length 2928 bp
Structure linear
Update Date 06-JAN-2013
Organism Homo sapiens (human)
Definition Homo sapiens POU class 3 homeobox 1 (POU3F1), mRNA.
Product POU domain, class 3, transcription factor 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL139158.11. On Jul 22, 2006 this sequence version replaced gi:27545318.

RefSeq NP_002690.3
CDS 36..1391
Misc Feature(1)774..998
Misc Feature(2)774..998
Misc Feature(3)1053..1226
Misc Feature(4)order(1053..1067,1071..1073,1122..1124,1140..1142,
Misc Feature(5)order(1059..1061,1068..1070,1188..1190,1197..1202,
Exon (1)1..2928
Gene:POU3F1
Gene Synonym:OCT6; OTF6; SCIP
Translation MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGA GAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQG AAHAGAAWAQGSTAHHLGPAMSPSPGASGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGG GGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSS VGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQ LSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLK CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPG GGGASPPSAPPPPPPAALHHHHHHTLPGSVQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(989)-t, cdbSNP:148233013
complement(1012..1013)-, cdbSNP:137999311
complement(1038)-t, cdbSNP:141969937
complement(1157)-g, adbSNP:147015857
complement(1220)-t, cdbSNP:145557249
complement(1307)-t, adbSNP:201037684
complement(1502..1503)-, tdbSNP:35099707
complement(1879)-t, cdbSNP:149981726
complement(1917..1918)-, adbSNP:113103101
complement(2129)-g, adbSNP:186256033
complement(2156)-t, gdbSNP:7412444
complement(2163)-, tdbSNP:71991934
complement(2164)-t, cdbSNP:201731676
complement(2167)-t, gdbSNP:77586752
complement(2171)-t, cdbSNP:28650302
complement(2172)-t, gdbSNP:28702711
complement(2180..2183)-, ttttdbSNP:75613156
complement(2183)-, tdbSNP:5773610
complement(2183)-t, gdbSNP:62676861
complement(2184)-, gdbSNP:138024979
complement(2297)-g, adbSNP:34860389
complement(2337)-, gdbSNP:35823623
complement(2567)-c, adbSNP:28418984
complement(2653)-g, adbSNP:55870461
complement(2674)-t, gdbSNP:55784678
complement(2775)-g, cdbSNP:41268251
complement(2875)-, tdbSNP:200879858
Gene SymbolPOU3F1
Gene SynonymOCT6; OTF6; SCIP
Chromosome1
Locus Map1p34.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002699 Homo sapiens POU class 3 homeobox 1 (POU3F1), mRNA. On-demand TBD TBD
Title Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women .
Author Fox,C.S., Liu,Y., White,C.C., Feitosa,M., Smith,A.V., Heard-Costa,N., Lohman,K., Johnson,A.D., Foster,M.C., Greenawalt,D.M., Griffin,P., Ding,J., Newman,A.B., Tylavsky,F., Miljkovic,I., Kritchevsky,S.B., Launer,L., Garcia,M., Eiriksdottir,G., Carr,J.J., Gudnason,V., Harris,T.B., Cupples,L.A. and Borecki,I.B.
Journal PLoS Genet. 8 (5), E1002695 (2012)
Title Aberrant CpG island hypermethylation and down-regulation of Oct-6 mRNA expression in human hepatocellular carcinoma .
Author Sun,J.Z., Yang,X.X., Li,X.H., Xu,W.W., Wang,Y., Zhu,W. and Li,M.
Journal Dig. Dis. Sci. 56 (10), 3072-3077 (2011)
Title Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci .
Author Stahl,E.A., Raychaudhuri,S., Remmers,E.F., Xie,G., Eyre,S., Thomson,B.P., Li,Y., Kurreeman,F.A., Zhernakova,A., Hinks,A., Guiducci,C., Chen,R., Alfredsson,L., Amos,C.I., Ardlie,K.G., Barton,A., Bowes,J., Brouwer,E., Burtt,N.P., Catanese,J.J., Coblyn,J., Coenen,M.J., Costenbader,K.H., Criswell,L.A., Crusius,J.B., Cui,J., de Bakker,P.I., De Jager,P.L., Ding,B., Emery,P., Flynn,E., Harrison,P., Hocking,L.J., Huizinga,T.W., Kastner,D.L., Ke,X., Lee,A.T., Liu,X., Martin,P., Morgan,A.W., Padyukov,L., Posthumus,M.D., Radstake,T.R., Reid,D.M., Seielstad,M., Seldin,M.F., Shadick,N.A., Steer,S., Tak,P.P., Thomson,W., van der Helm-van Mil,A.H., van der Horst-Bruinsma,I.E., van der Schoot,C.E., van Riel,P.L., Weinblatt,M.E., Wilson,A.G., Wolbink,G.J., Wordsworth,B.P., Wijmenga,C., Karlson,E.W., Toes,R.E., de Vries,N., Begovich,A.B., Worthington,J., Siminovitch,K.A., Gregersen,P.K., Klareskog,L. and Plenge,R.M.
Journal Nat. Genet. 42 (6), 508-514 (2010)
Title Misexpression of Pou3f1 results in peripheral nerve hypomyelination and axonal loss .
Author Ryu,E.J., Wang,J.Y., Le,N., Baloh,R.H., Gustin,J.A., Schmidt,R.E. and Milbrandt,J.
Journal J. Neurosci. 27 (43), 11552-11559 (2007)
Title Matrix metalloproteinase-19 expression in keratinocytes is repressed by transcription factors Tst-1 and Skn-1a: implications for keratinocyte differentiation .
Author Beck,I.M., Muller,M., Mentlein,R., Sadowski,T., Mueller,M.S., Paus,R. and Sedlacek,R.
Journal J. Invest. Dermatol. 127 (5), 1107-1114 (2007)
Title Functional interaction between the POU domain protein Tst-1/Oct-6 and the high-mobility-group protein HMG-I/Y .
Author Leger,H., Sock,E., Renner,K., Grummt,F. and Wegner,M.
Journal Mol. Cell. Biol. 15 (7), 3738-3747 (1995)
Title High mobility group protein 2 functionally interacts with the POU domains of octamer transcription factors .
Author Zwilling,S., Konig,H. and Wirth,T.
Journal EMBO J. 14 (6), 1198-1208 (1995)
Title Oct-6: a regulator of keratinocyte gene expression in stratified squamous epithelia .
Author Faus,I., Hsu,H.J. and Fuchs,E.
Journal Mol. Cell. Biol. 14 (5), 3263-3275 (1994)
Title Oct-6: a POU transcription factor expressed in embryonal stem cells and in the developing brain .
Author Suzuki,N., Rohdewohld,H., Neuman,T., Gruss,P. and Scholer,H.R.
Journal EMBO J. 9 (11), 3723-3732 (1990)
Title Expression and activity of the POU transcription factor SCIP .
Author Monuki,E.S., Kuhn,R., Weinmaster,G., Trapp,B.D. and Lemke,G.
Journal Science 249 (4974), 1300-1303 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.