• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 3 homeobox 1 (POU3F1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_002699 Homo sapiens POU class 3 homeobox 1 (POU3F1), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_002699.3, 110624764
Length 2928 bp
Structure linear
Update Date 26-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens POU class 3 homeobox 1 (POU3F1), mRNA.
Product POU domain, class 3, transcription factor 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL139158.11. On Jul 22, 2006 this sequence version replaced gi:27545318.

RefSeq NP_002690.3
CDS 36..1391
Misc Feature(1)774..998
Misc Feature(2)774..998
Misc Feature(3)1053..1226
Misc Feature(4)order(1053..1067,1071..1073,1122..1124,1140..1142,
Misc Feature(5)order(1059..1061,1068..1070,1188..1190,1197..1202,
Exon (1)1..2928
Gene:POU3F1
Gene Synonym:OCT6; OTF6; SCIP
Translation MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGA GAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQG AAHAGAAWAQGSTAHHLGPAMSPSPGASGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGG GGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSS VGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQ LSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLK CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPG GGGASPPSAPPPPPPAALHHHHHHTLPGSVQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(989)-t, cdbSNP:148233013
complement(1012..1013)-, cdbSNP:137999311
complement(1038)-t, cdbSNP:141969937
complement(1091)-g, adbSNP:370444231
complement(1144)-g, adbSNP:369867206
complement(1145)-g, adbSNP:376666397
complement(1157)-g, adbSNP:147015857
complement(1220)-t, cdbSNP:145557249
complement(1297)-t, cdbSNP:373192805
complement(1299)-t, cdbSNP:377734965
complement(1307)-t, adbSNP:201037684
complement(1489..1490)-, tdbSNP:35099707
complement(1502..1503)-, tdbSNP:373298489
complement(1804)-g, adbSNP:374679177
complement(1879)-t, cdbSNP:149981726
complement(1917..1918)-, adbSNP:113103101
complement(1999)-g, adbSNP:368510380
complement(2129)-g, adbSNP:186256033
complement(2132)-t, cdbSNP:371912492
complement(2156)-t, gdbSNP:7412444
complement(2164)-t, cdbSNP:201731676
complement(2166..2169)-, ttttdbSNP:75613156
complement(2166)-, tdbSNP:397738479
complement(2167)-t, gdbSNP:77586752
complement(2171)-t, cdbSNP:28650302
complement(2172)-t, gdbSNP:28702711
complement(2183)-, tdbSNP:5773610
complement(2183)-t, gdbSNP:62676861
complement(2184)-, gdbSNP:138024979
complement(2233)-g, cdbSNP:370424030
complement(2297)-g, adbSNP:34860389
complement(2334)-, gdbSNP:35823623
complement(2491)-g, adbSNP:369744531
complement(2567)-c, adbSNP:28418984
complement(2653)-g, adbSNP:55870461
complement(2674)-t, gdbSNP:55784678
complement(2775)-g, cdbSNP:41268251
complement(2841)-t, cdbSNP:374636908
complement(2867)-, tdbSNP:200879858
complement(2873)-t, adbSNP:376798290
Gene SymbolPOU3F1
Gene SynonymOCT6; OTF6; SCIP
Chromosome1
Locus Map1p34.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002699 Homo sapiens POU class 3 homeobox 1 (POU3F1), mRNA. On-demand TBD TBD
Title Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study .
Author Velez Edwards DR, Naj AC, Monda K, North KE, Neuhouser M, Magvanjav O, Kusimo I, Vitolins MZ, Manson JE, O'Sullivan MJ, Rampersaud E and Edwards TL.
Journal Hum. Genet. 132 (3), 323-336 (2013)
Title Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women .
Author Fox CS, Liu Y, White CC, Feitosa M, Smith AV, Heard-Costa N, Lohman K, Johnson AD, Foster MC, Greenawalt DM, Griffin P, Ding J, Newman AB, Tylavsky F, Miljkovic I, Kritchevsky SB, Launer L, Garcia M, Eiriksdottir G, Carr JJ, Gudnason V, Harris TB, Cupples LA and Borecki IB.
Journal PLoS Genet. 8 (5), E1002695 (2012)
Title Aberrant CpG island hypermethylation and down-regulation of Oct-6 mRNA expression in human hepatocellular carcinoma .
Author Sun JZ, Yang XX, Li XH, Xu WW, Wang Y, Zhu W and Li M.
Journal Dig. Dis. Sci. 56 (10), 3072-3077 (2011)
Title Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci .
Author Stahl EA, Raychaudhuri S, Remmers EF, Xie G, Eyre S, Thomson BP, Li Y, Kurreeman FA, Zhernakova A, Hinks A, Guiducci C, Chen R, Alfredsson L, Amos CI, Ardlie KG, Barton A, Bowes J, Brouwer E, Burtt NP, Catanese JJ, Coblyn J, Coenen MJ, Costenbader KH, Criswell LA, Crusius JB, Cui J, de Bakker PI, De Jager PL, Ding B, Emery P, Flynn E, Harrison P, Hocking LJ, Huizinga TW, Kastner DL, Ke X, Lee AT, Liu X, Martin P, Morgan AW, Padyukov L, Posthumus MD, Radstake TR, Reid DM, Seielstad M, Seldin MF, Shadick NA, Steer S, Tak PP, Thomson W, van der Helm-van Mil AH, van der Horst-Bruinsma IE, van der Schoot CE, van Riel PL, Weinblatt ME, Wilson AG, Wolbink GJ, Wordsworth BP, Wijmenga C, Karlson EW, Toes RE, de Vries N, Begovich AB, Worthington J, Siminovitch KA, Gregersen PK, Klareskog L and Plenge RM.
Journal Nat. Genet. 42 (6), 508-514 (2010)
Title Misexpression of Pou3f1 results in peripheral nerve hypomyelination and axonal loss .
Author Ryu EJ, Wang JY, Le N, Baloh RH, Gustin JA, Schmidt RE and Milbrandt J.
Journal J. Neurosci. 27 (43), 11552-11559 (2007)
Title Functional interaction between the POU domain protein Tst-1/Oct-6 and the high-mobility-group protein HMG-I/Y .
Author Leger H, Sock E, Renner K, Grummt F and Wegner M.
Journal Mol. Cell. Biol. 15 (7), 3738-3747 (1995)
Title High mobility group protein 2 functionally interacts with the POU domains of octamer transcription factors .
Author Zwilling S, Konig H and Wirth T.
Journal EMBO J. 14 (6), 1198-1208 (1995)
Title Oct-6: a regulator of keratinocyte gene expression in stratified squamous epithelia .
Author Faus I, Hsu HJ and Fuchs E.
Journal Mol. Cell. Biol. 14 (5), 3263-3275 (1994)
Title Oct-6: a POU transcription factor expressed in embryonal stem cells and in the developing brain .
Author Suzuki N, Rohdewohld H, Neuman T, Gruss P and Scholer HR.
Journal EMBO J. 9 (11), 3723-3732 (1990)
Title Expression and activity of the POU transcription factor SCIP .
Author Monuki ES, Kuhn R, Weinmaster G, Trapp BD and Lemke G.
Journal Science 249 (4974), 1300-1303 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.